Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTPQI71S)

DOT Name	M-phase inducer phosphatase 3 (CDC25C)
Synonyms	EC 3.1.3.48; Dual specificity phosphatase Cdc25C
Gene Name	CDC25C
UniProt ID	MPIP3_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2OJX; 3BZI; 3OP3; 5M35; 5M36; 5M37
EC Number	3.1.3.48
Pfam ID	PF06617 ; PF00581
Sequence	MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Function	Functions as a dosage-dependent inducer in mitotic control. Tyrosine protein phosphatase required for progression of the cell cycle. When phosphorylated, highly effective in activating G2 cells into prophase. Directly dephosphorylates CDK1 and activates its kinase activity.
KEGG Pathway	Cell cycle (hsa04110 ) Oocyte meiosis (hsa04114 ) Progesterone-mediated oocyte maturation (hsa04914 ) Human immunodeficiency virus 1 infection (hsa05170 ) MicroR.s in cancer (hsa05206 )
Reactome Pathway	Activation of ATR in response to replication stress (R-HSA-176187 ) RHO GTPases activate PKNs (R-HSA-5625740 ) TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest (R-HSA-6804114 ) TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain (R-HSA-6804115 ) Cyclin A/B1/B2 associated events during G2/M transition (R-HSA-69273 ) Chk1/Chk2(Cds1) mediated inactivation of Cyclin B (R-HSA-75035 ) Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models (R-HSA-8862803 ) Polo-like kinase mediated events (R-HSA-156711 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	M-phase inducer phosphatase 3 (CDC25C) affects the response to substance of Fluorouracil.	[62]
------------------------------------------------------------------------------------

62 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[7]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[2]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[12]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of M-phase inducer phosphatase 3 (CDC25C).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[15]
Marinol	DM70IK5	Approved	Marinol decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[17]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[18]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[19]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[20]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[21]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[22]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[23]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[24]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[25]
Acetic Acid, Glacial	DM4SJ5Y	Approved	Acetic Acid, Glacial increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[26]
Motexafin gadolinium	DMEJKRF	Approved	Motexafin gadolinium increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[26]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[27]
Silymarin	DMXBYQR	Phase 4	Silymarin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[28]
Rigosertib	DMOSTXF	Phase 3	Rigosertib decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[31]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[33]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[35]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[36]
NVP-AUY922	DMTYXQF	Phase 2	NVP-AUY922 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[36]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[21]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[38]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[39]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[40]
Arecoline	DMFJZK3	Phase 1	Arecoline decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[41]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[43]
Harmine	DMPA5WD	Patented	Harmine increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[44]
TDZD-8	DMG6Q45	Patented	TDZD-8 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[45]
PJ34	DMXO6YH	Preclinical	PJ34 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[47]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[48]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[49]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[50]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[51]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[45]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[21]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[52]
Apigenin	DMI3491	Investigative	Apigenin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[52]
3,7,3',4'-TETRAHYDROXYFLAVONE	DMES906	Investigative	3,7,3',4'-TETRAHYDROXYFLAVONE decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[53]
GW-3965	DMG60ET	Investigative	GW-3965 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[54]
Morin	DM2OGZ5	Investigative	Morin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[55]
NORCANTHARIDIN	DM9B6Y1	Investigative	NORCANTHARIDIN decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[56]
Ellipticine	DMHPYSM	Investigative	Ellipticine decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[57]
Acacetin	DMQOB0X	Investigative	Acacetin decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[58]
G15	DMMEC9D	Investigative	G15 decreases the expression of M-phase inducer phosphatase 3 (CDC25C).	[59]
Leupeptin	DMU075F	Investigative	Leupeptin increases the expression of M-phase inducer phosphatase 3 (CDC25C).	[61]
------------------------------------------------------------------------------------


⏷ Show the Full List of 62 Drug(s)

7 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of M-phase inducer phosphatase 3 (CDC25C).	[8]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[29]
Curcumin	DMQPH29	Phase 3	Curcumin increases the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[30]
VAL-083	DM9J5Q4	Phase 3	VAL-083 increases the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[32]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[34]
PF-04991532	DM94NBE	Phase 2	PF-04991532 decreases the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[37]
NSC-106970	DMHK0F6	Investigative	NSC-106970 affects the phosphorylation of M-phase inducer phosphatase 3 (CDC25C).	[60]
------------------------------------------------------------------------------------


⏷ Show the Full List of 7 Drug(s)

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
3	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
4	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
5	RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
6	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
8	Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9	Arsenic trioxide-mediated growth inhibition in MC/CAR myeloma cells via cell cycle arrest in association with induction of cyclin-dependent kinase inhibitor, p21, and apoptosis. Cancer Res. 2000 Jun 1;60(11):3065-71.
10	Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
11	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
12	Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
13	Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
14	Functional gene expression profile underlying methotrexate-induced senescence in human colon cancer cells. Tumour Biol. 2011 Oct;32(5):965-76.
15	DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
16	Delta9-tetrahydrocannabinol inhibits cell cycle progression in human breast cancer cells through Cdc2 regulation. Cancer Res. 2006 Jul 1;66(13):6615-21. doi: 10.1158/0008-5472.CAN-05-4566.
17	The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
18	Cannabidiol-induced transcriptomic changes and cellular senescence in human Sertoli cells. Toxicol Sci. 2023 Feb 17;191(2):227-238. doi: 10.1093/toxsci/kfac131.
19	Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
20	A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
21	Responses of genes involved in cell cycle control to diverse DNA damaging chemicals in human lung adenocarcinoma A549 cells. Cancer Cell Int. 2005 Aug 24;5:28. doi: 10.1186/1475-2867-5-28.
22	Marked regression of liver metastasis by combined therapy of ultrasound-mediated NF kappaB-decoy transfer and transportal injection of paclitaxel, in mouse. Int J Cancer. 2008 Apr 1;122(7):1645-56. doi: 10.1002/ijc.23280.
23	Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
24	Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
25	Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
26	Motexafin gadolinium and zinc induce oxidative stress responses and apoptosis in B-cell lymphoma lines. Cancer Res. 2005 Dec 15;65(24):11676-88.
27	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
28	Identifying the differential effects of silymarin constituents on cell growth and cell cycle regulatory molecules in human prostate cancer cells. Int J Cancer. 2008 Jul 1;123(1):41-50. doi: 10.1002/ijc.23485.
29	Resveratrol causes Cdc2-tyr15 phosphorylation via ATM/ATR-Chk1/2-Cdc25C pathway as a central mechanism for S phase arrest in human ovarian carcinoma Ovcar-3 cells. Carcinogenesis. 2005 Nov;26(11):1978-87. doi: 10.1093/carcin/bgi165. Epub 2005 Jun 23.
30	Activation of ATM/Chk1 by curcumin causes cell cycle arrest and apoptosis in human pancreatic cancer cells. Br J Cancer. 2009 May 5;100(9):1425-33. doi: 10.1038/sj.bjc.6605039.
31	A fine-needle aspirate-based vulnerability assay identifies polo-like kinase 1 as a mediator of gemcitabine resistance in pancreatic cancer. Mol Cancer Ther. 2010 Feb;9(2):311-8. doi: 10.1158/1535-7163.MCT-09-0693. Epub 2010 Jan 26.
32	1,2:5,6-dianhydrogalactitol inhibits human glioma cell growth in vivo and in vitro by arresting the cell cycle at G(2)/M phase. Acta Pharmacol Sin. 2017 Apr;38(4):561-570. doi: 10.1038/aps.2016.154. Epub 2017 Feb 20.
33	Molecular signatures of soy-derived phytochemicals in androgen-responsive prostate cancer cells: a comparison study using DNA microarray. Mol Carcinog. 2006 Dec;45(12):943-56.
34	Neoplastic alterations induced in mammalian skin following mancozeb exposure using in vivo and in vitro models. OMICS. 2011 Mar;15(3):155-67. doi: 10.1089/omi.2010.0076.
35	Phenethyl isothiocyanate alters the gene expression and the levels of protein associated with cell cycle regulation in human glioblastoma GBM 8401 cells. Environ Toxicol. 2017 Jan;32(1):176-187.
36	Gene expression-based chemical genomics identifies heat-shock protein 90 inhibitors as potential therapeutic drugs in cholangiocarcinoma. Cancer. 2013 Jan 15;119(2):293-303. doi: 10.1002/cncr.27743. Epub 2012 Jul 18.
37	In vitro antitumor mechanism of (E)-N-(2-methoxy-5-(((2,4,6-trimethoxystyryl)sulfonyl)methyl)pyridin-3-yl)methanesulfonamide. Mol Pharmacol. 2015 Jan;87(1):18-30. doi: 10.1124/mol.114.093245. Epub 2014 Oct 14.
38	The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
39	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
40	Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
41	Arecoline decreases interleukin-6 production and induces apoptosis and cell cycle arrest in human basal cell carcinoma cells. Toxicol Appl Pharmacol. 2012 Jan 15;258(2):199-207. doi: 10.1016/j.taap.2011.11.001. Epub 2011 Nov 13.
42	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
43	Caffeine induces TP53-independent G(1)-phase arrest and apoptosis in human lung tumor cells in a dose-dependent manner. Radiat Res. 2002 Feb;157(2):166-74. doi: 10.1667/0033-7587(2002)157[0166:citigp]2.0.co;2.
44	A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication. Nat Med. 2015 Apr;21(4):383-8. doi: 10.1038/nm.3820. Epub 2015 Mar 9.
45	Lithium suppresses cell proliferation by interrupting E2F-DNA interaction and subsequently reducing S-phase gene expression in prostate cancer. Prostate. 2007 Jun 15;67(9):976-88. doi: 10.1002/pros.20586.
46	The PARP inhibitor PJ34 causes a PARP1-independent, p21 dependent mitotic arrest. DNA Repair (Amst). 2011 Oct 10;10(10):1003-13. doi: 10.1016/j.dnarep.2011.07.006. Epub 2011 Aug 12.
47	Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
48	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
49	Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
50	Ochratoxin A induces G(2) phase arrest in human gastric epithelium GES-1 cells in vitro. Toxicol Lett. 2010 Mar 15;193(2):152-8. doi: 10.1016/j.toxlet.2009.12.019. Epub 2010 Jan 7.
51	Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
52	Tributyltin induces G2/M cell cycle arrest via NAD(+)-dependent isocitrate dehydrogenase in human embryonic carcinoma cells. J Toxicol Sci. 2016 Apr;41(2):207-15. doi: 10.2131/jts.41.207.
53	Fisetin-induced apoptosis of human oral cancer SCC-4 cells through reactive oxygen species production, endoplasmic reticulum stress, caspase-, and mitochondria-dependent signaling pathways. Environ Toxicol. 2017 Jun;32(6):1725-1741. doi: 10.1002/tox.22396. Epub 2017 Feb 9.
54	System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
55	Molecular mechanism of anti-cancerous potential of Morin extracted from mulberry in Hela cells. Food Chem Toxicol. 2018 Feb;112:466-475. doi: 10.1016/j.fct.2017.07.002. Epub 2017 Jul 6.
56	Norcantharidin induces apoptosis of breast cancer cells: involvement of activities of mitogen activated protein kinases and signal transducers and activators of transcription. Toxicol In Vitro. 2011 Apr;25(3):699-707. doi: 10.1016/j.tiv.2011.01.011. Epub 2011 Jan 23.
57	The anti-proliferative inhibition of ellipticine in human breast mda-mb-231 cancer cells is through cell cycle arrest and apoptosis induction. Anticancer Drugs. 2005 Aug;16(7):789-95. doi: 10.1097/01.cad.0000171768.36317.93.
58	Acacetin induces sustained ERK1/2 activation and RIP1-dependent necroptotic death in breast cancer cells. Toxicol Appl Pharmacol. 2023 Mar 1;462:116409. doi: 10.1016/j.taap.2023.116409. Epub 2023 Feb 3.
59	G15, a GPR30 antagonist, induces apoptosis and autophagy in human oral squamous carcinoma cells. Chem Biol Interact. 2013 Nov 25;206(2):375-84. doi: 10.1016/j.cbi.2013.10.014. Epub 2013 Oct 23.
60	5,7,3'-Trihydroxy-3,4'-dimethoxyflavone inhibits the tubulin polymerization and activates the sphingomyelin pathway. Mol Carcinog. 2011 Feb;50(2):113-22. doi: 10.1002/mc.20693. Epub 2010 Dec 10.
61	Xanthatin triggers Chk1-mediated DNA damage response and destabilizes Cdc25C via lysosomal degradation in lung cancer cells. Toxicol Appl Pharmacol. 2017 Dec 15;337:85-94. doi: 10.1016/j.taap.2017.10.015. Epub 2017 Oct 23.
62	Mechanistic and predictive profiling of 5-Fluorouracil resistance in human cancer cells. Cancer Res. 2004 Nov 15;64(22):8167-76. doi: 10.1158/0008-5472.CAN-04-0970.