Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQYEWZQ)

• DOT Name: Aminomethyltransferase, mitochondrial (AMT)
• Synonyms: EC 2.1.2.10; Glycine cleavage system T protein; GCVT
• Gene Name: AMT
• Related Disease:
  Glycine encephalopathy
  Neural tube defect
  Acidosis
  Autism spectrum disorder
  Colorectal carcinoma
  Corneal ulcer
  Creutzfeldt Jacob disease
  Depression
  Diabetic kidney disease
  Early myoclonic encephalopathy
  Epilepsy
  Factor IX deficiency
  Gynecologic cancer
  Insomnia
  Metabolic disorder
  Multiple sclerosis
  Nasal polyp
  Neoplasm
  Silver-Russell syndrome
  Atypical glycine encephalopathy
  Infantile glycine encephalopathy
  Neonatal glycine encephalopathy
  Glaucoma/ocular hypertension
  Advanced cancer
  Crohn disease
  Familial lipoprotein lipase deficiency
  Lymphoma
  Pancreatitis
• UniProt ID: GCST_HUMAN
• PDB ID: 1WSR; 1WSV
• EC Number: 2.1.2.10
• Pfam ID: PF01571 ; PF08669
• Sequence:
  MQRAVSVVARLGFRLQAFPPALCRPLSCAQEVLRRTPLYDFHLAHGGKMVAFAGWSLPVQ
  YRDSHTDSHLHTRQHCSLFDVSHMLQTKILGSDRVKLMESLVVGDIAELRPNQGTLSLFT
  NEAGGILDDLIVTNTSEGHLYVVSNAGCWEKDLALMQDKVRELQNQGRDVGLEVLDNALL
  ALQGPTAAQVLQAGVADDLRKLPFMTSAVMEVFGVSGCRVTRCGYTGEDGVEISVPVAGA
  VHLATAILKNPEVKLAGLAARDSLRLEAGLCLYGNDIDEHTTPVEGSLSWTLGKRRRAAM
  DFPGAKVIVPQLKGRVQRRRVGLMCEGAPMRAHSPILNMEGTKIGTVTSGCPSPSLKKNV
  AMGYVPCEYSRPGTMLLVEVRRKQQMAVVSKMPFVPTNYYTLK
• Function: The glycine cleavage system catalyzes the degradation of glycine.
• KEGG Pathway:
  Glycine, serine and threonine metabolism (hsa00260)
  Glyoxylate and dicarboxylate metabolism (hsa00630)
  One carbon pool by folate (hsa00670)
  Lipoic acid metabolism (hsa00785)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
• Reactome Pathway: Glycine degradation (R-HSA-6783984)
• BioCyc Pathway: MetaCyc:HS07223-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Glycine encephalopathy	DISI2XE5	Definitive	Autosomal recessive	[1]
Neural tube defect	DIS5J95E	Definitive	Genetic Variation	[2]
Acidosis	DISJQTX1	Strong	Biomarker	[3]
Autism spectrum disorder	DISXK8NV	Strong	Genetic Variation	[4]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[5]
Corneal ulcer	DIS8YN8N	Strong	Biomarker	[6]
Creutzfeldt Jacob disease	DISCB6RX	Strong	Biomarker	[7]
Depression	DIS3XJ69	Strong	Biomarker	[8]
Diabetic kidney disease	DISJMWEY	Strong	Genetic Variation	[9]
Early myoclonic encephalopathy	DIS1YXVQ	Strong	Genetic Variation	[10]
Epilepsy	DISBB28L	Strong	Biomarker	[11]
Factor IX deficiency	DISHN9SC	Strong	Genetic Variation	[12]
Gynecologic cancer	DIST2NIJ	Strong	Biomarker	[8]
Insomnia	DIS0AFR7	Strong	Biomarker	[8]
Metabolic disorder	DIS71G5H	Strong	Biomarker	[13]
Multiple sclerosis	DISB2WZI	Strong	Biomarker	[14]
Nasal polyp	DISLP3XE	Strong	Altered Expression	[15]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Silver-Russell syndrome	DISSVJ1D	Strong	Genetic Variation	[16]
Atypical glycine encephalopathy	DIS9KV6Z	Supportive	Unknown	[17]
Infantile glycine encephalopathy	DISLOECI	Supportive	Autosomal recessive	[17]
Neonatal glycine encephalopathy	DIS7A6BM	Supportive	Autosomal recessive	[17]
Glaucoma/ocular hypertension	DISLBXBY	Disputed	Biomarker	[18]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[19]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[20]
Familial lipoprotein lipase deficiency	DIS0M7NJ	Limited	Genetic Variation	[21]
Lymphoma	DISN6V4S	Limited	Biomarker	[22]
Pancreatitis	DIS0IJEF	Limited	Genetic Variation	[21]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Aminomethyltransferase, mitochondrial (AMT).	[23]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[24]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[25]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[26]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Aminomethyltransferase, mitochondrial (AMT).	[27]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[28]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[29]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[30]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Aminomethyltransferase, mitochondrial (AMT).	[31]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[32]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[33]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Aminomethyltransferase, mitochondrial (AMT).	[34]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Aminomethyltransferase, mitochondrial (AMT).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Aminomethyltransferase, mitochondrial (AMT).	[36]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Mutations of the glycine cleavage system genes possibly affect the negative symptoms of schizophrenia through metabolomic profile changes.Psychiatry Clin Neurosci. 2018 Mar;72(3):168-179. doi: 10.1111/pcn.12628. Epub 2018 Jan 31.
• [3] Increased activity of renal glycine-cleavage-enzyme complex in metabolic acidosis.Biochem J. 1985 Oct 15;231(2):477-80. doi: 10.1042/bj2310477.
• [4] Using whole-exome sequencing to identify inherited causes of autism.Neuron. 2013 Jan 23;77(2):259-73. doi: 10.1016/j.neuron.2012.11.002.
• [5] The tumor-suppressor gene LZTS1 suppresses colorectal cancer proliferation through inhibition of the AKT-mTOR signaling pathway.Cancer Lett. 2015 Apr 28;360(1):68-75. doi: 10.1016/j.canlet.2015.02.004. Epub 2015 Feb 7.
• [6] Full-thickness conjunctival flap covering surgery combined with amniotic membrane transplantation for severe fungal keratitis.Exp Ther Med. 2018 Mar;15(3):2711-2718. doi: 10.3892/etm.2018.5765. Epub 2018 Jan 17.
• [7] Different 2-Aminothiazole Therapeutics Produce Distinct Patterns of Scrapie Prion Neuropathology in Mouse Brains.J Pharmacol Exp Ther. 2015 Oct;355(1):2-12. doi: 10.1124/jpet.115.224659. Epub 2015 Jul 29.
• [8] Effects of Anma therapy (Japanese massage) on health-related quality of life in gynecologic cancer survivors: A randomized controlled trial.PLoS One. 2018 May 3;13(5):e0196638. doi: 10.1371/journal.pone.0196638. eCollection 2018.
• [9] Renin-angiotensin-aldosterone system genotypes and haplotypes affect the susceptibility to nephropathy in type 2 diabetes patients.J Renin Angiotensin Aldosterone Syst. 2011 Dec;12(4):572-80. doi: 10.1177/1470320310396542. Epub 2011 Mar 18.
• [10] A novel AMT gene mutation in a newborn with nonketotic hyperglycinemia and early myoclonic encephalopathy.Eur J Paediatr Neurol. 2016 Jan;20(1):192-5. doi: 10.1016/j.ejpn.2015.08.008. Epub 2015 Sep 5.
• [11] Multimodality imaging for improved detection of epileptogenic foci in tuberous sclerosis complex.Neurology. 2000 May 23;54(10):1976-84. doi: 10.1212/wnl.54.10.1976.
• [12] Enhanced Factor IX Activity following Administration of AAV5-R338L "Padua" Factor IX versus AAV5 WT Human Factor IX in NHPs.Mol Ther Methods Clin Dev. 2019 Sep 26;15:221-231. doi: 10.1016/j.omtm.2019.09.005. eCollection 2019 Dec 13.
• [13] The effect of hyperglycinemic treatment in captive-bred Vervet monkeys (Chlorocebus aethiops).Metab Brain Dis. 2019 Oct;34(5):1467-1472. doi: 10.1007/s11011-019-00449-6. Epub 2019 Jun 22.
• [14] Asymmetry of Brain Excitability: A New Biomarker that Predicts Objective and Subjective Symptoms in Multiple Sclerosis.Behav Brain Res. 2019 Feb 1;359:281-291. doi: 10.1016/j.bbr.2018.11.005. Epub 2018 Nov 6.
• [15] RKIP and BRAF aberrations in human nasal polyps and the adjacent turbinate mucosae.Cancer Lett. 2008 Jun 18;264(2):288-98. doi: 10.1016/j.canlet.2008.01.046. Epub 2008 Mar 10.
• [16] Methylation profiling in individuals with Russell-Silver syndrome.Am J Med Genet A. 2010 Feb;152A(2):347-55. doi: 10.1002/ajmg.a.33204.
• [17] Nonketotic Hyperglycinemia. 2002 Nov 14 [updated 2019 May 23]. In: Adam MP, Feldman J, Mirzaa GM, Pagon RA, Wallace SE, Bean LJH, Gripp KW, Amemiya A, editors. GeneReviews(?) [Internet]. Seattle (WA): University of Washington, Seattle; 1993C2024.
• [18] Staged ocular fornix reconstruction for glaucoma drainage device under neoconjunctiva at the time of Boston type 1 Keratoprosthesis implantation.Ocul Surf. 2019 Apr;17(2):336-340. doi: 10.1016/j.jtos.2019.01.010. Epub 2019 Feb 8.
• [19] Synthesis of 5-[(18)F]Fluoro--methyl Tryptophan: New Trp Based PET Agents.Theranostics. 2017 Apr 7;7(6):1524-1530. doi: 10.7150/thno.19371. eCollection 2017.
• [20] Genome-wide association study for Crohn's disease in the Quebec Founder Population identifies multiple validated disease loci.Proc Natl Acad Sci U S A. 2007 Sep 11;104(37):14747-52. doi: 10.1073/pnas.0706645104. Epub 2007 Sep 5.
• [21] Alipogene tiparvovec: a review of its use in adults with familial lipoprotein lipase deficiency.Drugs. 2015 Feb;75(2):175-82. doi: 10.1007/s40265-014-0339-9.
• [22] Clinicopathologic study of CD56 (NCAM)-positive angiocentric lymphoma occurring in sites other than the upper and lower respiratory tract.Am J Surg Pathol. 1995 Mar;19(3):284-96. doi: 10.1097/00000478-199503000-00006.
• [23] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [24] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [25] Increased mitochondrial ROS formation by acetaminophen in human hepatic cells is associated with gene expression changes suggesting disruption of the mitochondrial electron transport chain. Toxicol Lett. 2015 Apr 16;234(2):139-50.
• [26] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [27] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [28] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [29] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [30] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [31] Proteomic analysis of antiproliferative effects by treatment of 5-fluorouracil in cervical cancer cells. DNA Cell Biol. 2004 Nov;23(11):769-76.
• [32] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [33] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [34] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [35] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [36] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.