Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSBF2MO)

DOT Name	Glutathione S-transferase Mu 1 (GSTM1)
Synonyms	EC 2.5.1.18; GST HB subunit 4; GST class-mu 1; GSTM1-1; GSTM1a-1a; GSTM1b-1b; GTH4
Gene Name	GSTM1
UniProt ID	GSTM1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	1GTU; 1XW6; 1XWK; 1YJ6; 2F3M; 7BEU
EC Number	2.5.1.18
Pfam ID	PF00043 ; PF02798
Sequence	MPMILGYWDIRGLAHAIRLLLEYTDSSYEEKKYTMGDAPDYDRSQWLNEKFKLGLDFPNL PYLIDGAHKITQSNAILCYIARKHNLCGETEEEKIRVDILENQTMDNHMQLGMICYNPEF EKLKPKYLEELPEKLKLYSEFLGKRPWFAGNKITFVDFLVYDVLDLHRIFEPKCLDAFPN LKDFISRFEGLEKISAYMKSSRFLPRPVFSKMAVWGNK
Function	Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Involved in the formation of glutathione conjugates of both prostaglandin A2 (PGA2) and prostaglandin J2 (PGJ2). Participates in the formation of novel hepoxilin regioisomers.
Tissue Specificity	Liver (at protein level).
KEGG Pathway	Glutathione metabolism (hsa00480 ) Metabolism of xenobiotics by cytochrome P450 (hsa00980 ) Drug metabolism - cytochrome P450 (hsa00982 ) Drug metabolism - other enzymes (hsa00983 ) Metabolic pathways (hsa01100 ) Platinum drug resistance (hsa01524 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - D. adducts (hsa05204 ) Chemical carcinogenesis - receptor activation (hsa05207 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Hepatocellular carcinoma (hsa05225 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	Azathioprine ADME (R-HSA-9748787 ) Paracetamol ADME (R-HSA-9753281 ) Glutathione conjugation (R-HSA-156590 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 28 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Cisplatin.	[25]
Arsenic	DMTL2Y1	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Arsenic.	[26]
Carbamazepine	DMZOLBI	Approved	Glutathione S-transferase Mu 1 (GSTM1) increases the response to substance of Carbamazepine.	[27]
Methotrexate	DM2TEOL	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Methotrexate.	[28]
Dexamethasone	DMMWZET	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Dexamethasone.	[29]
Troglitazone	DM3VFPD	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Troglitazone.	[30]
Hydroquinone	DM6AVR4	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Hydroquinone.	[31]
Azathioprine	DMMZSXQ	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Azathioprine.	[32]
Ethanol	DMDRQZU	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Ethanol.	[33]
Cytarabine	DMZD5QR	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Cytarabine.	[34]
Aspirin	DM672AH	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Aspirin.	[35]
Etoposide	DMNH3PG	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Etoposide.	[34]
Clozapine	DMFC71L	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the activity of Clozapine.	[36]
DTI-015	DMXZRW0	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of DTI-015.	[29]
Melphalan	DMOLNHF	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Melphalan.	[29]
Methamphetamine	DMPM4SK	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Methamphetamine.	[37]
Daunorubicin	DMQUSBT	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Daunorubicin.	[34]
Lindane	DMB8CNL	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Lindane.	[38]
Vitamin C	DMXJ7O8	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Vitamin C.	[39]
Isoniazid	DM5JVS3	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Isoniazid.	[40]
Chlorambucil	DMRKE63	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the response to substance of Chlorambucil.	[43]
Epanova	DMHEAGL	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Epanova.	[45]
Prednisone	DM2HG4X	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Prednisone.	[34]
Mercaptopurine	DMTM2IK	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of Mercaptopurine.	[34]
Benzo(a)pyrene	DMN7J43	Phase 1	Glutathione S-transferase Mu 1 (GSTM1) increases the response to substance of Benzo(a)pyrene.	[48]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	Glutathione S-transferase Mu 1 (GSTM1) affects the response to substance of 2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE.	[49]
Aminohippuric acid	DMUN54G	Investigative	Glutathione S-transferase Mu 1 (GSTM1) increases the response to substance of Aminohippuric acid.	[50]
1,6-hexamethylene diisocyanate	DMLB3RT	Investigative	Glutathione S-transferase Mu 1 (GSTM1) increases the response to substance of 1,6-hexamethylene diisocyanate.	[51]
------------------------------------------------------------------------------------


⏷ Show the Full List of 28 Drug(s)

This DOT Affected the Regulation of Drug Effects of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Glutathione	DMAHMT9	Approved	Glutathione S-transferase Mu 1 (GSTM1) decreases the abundance of Glutathione.	[41]
Busulfan	DMXYJ9C	Approved	Glutathione S-transferase Mu 1 (GSTM1) affects the abundance of Busulfan.	[44]
PEITC	DMOMN31	Phase 2	Glutathione S-transferase Mu 1 (GSTM1) affects the metabolism of PEITC.	[47]
PGJ2	DMR2LTC	Investigative	Glutathione S-transferase Mu 1 (GSTM1) affects the metabolism of PGJ2.	[52]
Prostaglandin A2	DMWC4X8	Investigative	Glutathione S-transferase Mu 1 (GSTM1) affects the metabolism of Prostaglandin A2.	[52]
------------------------------------------------------------------------------------

This DOT Affected the Biotransformations of 3 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Nevirapine	DM6HX9B	Approved	Glutathione S-transferase Mu 1 (GSTM1) increases the glutathionylation of Nevirapine.	[42]
Mefenamic acid	DMK7HFI	Approved	Glutathione S-transferase Mu 1 (GSTM1) increases the glutathionylation of Mefenamic acid.	[46]
DNCB	DMDTVYC	Phase 2	Glutathione S-transferase Mu 1 (GSTM1) increases the glutathionylation of DNCB.	[40]
------------------------------------------------------------------------------------

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[1]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[2]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[3]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[4]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[5]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[6]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[6]
Phenobarbital	DMXZOCG	Approved	Phenobarbital increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[7]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[1]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Glutathione S-transferase Mu 1 (GSTM1).	[8]
Diclofenac	DMPIHLS	Approved	Diclofenac decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[9]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[1]
Dopamine	DMPGUCF	Approved	Dopamine decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[10]
Quinidine	DMLPICK	Approved	Quinidine decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[11]
Quinine	DMSWYF5	Approved	Quinine decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[11]
Methyldopa	DM5I621	Approved	Methyldopa decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[10]
Rifamycin	DMEH3O7	Approved	Rifamycin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[12]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[13]
ACYLINE	DM9GRTK	Phase 2	ACYLINE decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[14]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[15]
Eugenol	DM7US1H	Patented	Eugenol decreases the activity of Glutathione S-transferase Mu 1 (GSTM1).	[16]
Taxifolin	DMQJSF9	Preclinical	Taxifolin increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[17]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[18]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[19]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A affects the expression of Glutathione S-transferase Mu 1 (GSTM1).	[20]
Okadaic acid	DM47CO1	Investigative	Okadaic acid increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[21]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[22]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[23]
all-trans-4-oxo-retinoic acid	DMM2R1N	Investigative	all-trans-4-oxo-retinoic acid decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[1]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol increases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[24]
3-Methylpyridine	DMF3JHM	Investigative	3-Methylpyridine decreases the expression of Glutathione S-transferase Mu 1 (GSTM1).	[12]
------------------------------------------------------------------------------------


⏷ Show the Full List of 31 Drug(s)

References

1	Retinoic acid and its 4-oxo metabolites are functionally active in human skin cells in vitro. J Invest Dermatol. 2005 Jul;125(1):143-53.
2	Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
3	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
4	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
5	Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
6	Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
7	Xenobiotic CAR activators induce Dlk1-Dio3 locus noncoding RNA expression in mouse liver. Toxicol Sci. 2017 Aug 1;158(2):367-378.
8	Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
9	Simulation of interindividual differences in inactivation of reactive para-benzoquinone imine metabolites of diclofenac by glutathione S-transferases in human liver cytosol. Toxicol Lett. 2016 Jul 25;255:52-62.
10	Inhibition of human glutathione S-transferases by dopamine, alpha-methyldopa and their 5-S-glutathionyl conjugates. Chem Biol Interact. 1994 Jan;90(1):87-99.
11	Inhibition of glutathione S-transferases by antimalarial drugs possible implications for circumventing anticancer drug resistance. Int J Cancer. 2002 Feb 10;97(5):700-5.
12	The influence of picolines on glutathione transferase activity and subunit composition in human liver derived Hep G2 cells. Biochem Pharmacol. 1994 Nov 16;48(10):1976-8.
13	Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
14	Intraprostatic androgens and androgen-regulated gene expression persist after testosterone suppression: therapeutic implications for castration-resistant prostate cancer. Cancer Res. 2007 May 15;67(10):5033-41.
15	OTX015 Epi-Drug Exerts Antitumor Effects in Ovarian Cancer Cells by Blocking GNL3-Mediated Radioresistance Mechanisms: Cellular, Molecular and Computational Evidence. Cancers (Basel). 2021 Mar 25;13(7):1519. doi: 10.3390/cancers13071519.
16	Inhibition of rat, mouse, and human glutathione S-transferase by eugenol and its oxidation products. Chem Biol Interact. 1996 Jan 5;99(1-3):85-97.
17	The chemopreventive effect of taxifolin is exerted through ARE-dependent gene regulation. Biol Pharm Bull. 2007 Jun;30(6):1074-9.
18	Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
19	Sulforaphane-stimulated phase II enzyme induction inhibits cytokine production by airway epithelial cells stimulated with diesel extract. Am J Physiol Lung Cell Mol Physiol. 2007 Jan;292(1):L33-9. doi: 10.1152/ajplung.00170.2006. Epub 2006 Aug 11.
20	Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
21	Whole genome mRNA transcriptomics analysis reveals different modes of action of the diarrheic shellfish poisons okadaic acid and dinophysis toxin-1 versus azaspiracid-1 in Caco-2 cells. Toxicol In Vitro. 2018 Feb;46:102-112.
22	Integrating biokinetics and in vitro studies to evaluate developmental neurotoxicity induced by chlorpyrifos in human iPSC-derived neural stem cells undergoing differentiation towards neuronal and glial cells. Reprod Toxicol. 2020 Dec;98:174-188. doi: 10.1016/j.reprotox.2020.09.010. Epub 2020 Oct 1.
23	Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
24	tBHQ-induced HO-1 expression is mediated by calcium through regulation of Nrf2 binding to enhancer and polymerase II to promoter region of HO-1. Chem Res Toxicol. 2011 May 16;24(5):670-6.
25	Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
26	Cytogenetic damage and genetic variants in the individuals susceptible to arsenic-induced cancer through drinking water. Int J Cancer. 2006 May 15;118(10):2470-8. doi: 10.1002/ijc.21640.
27	Glutathione S-transferase M1 null genotype as a risk factor for carbamazepine-induced mild hepatotoxicity. Pharmacogenomics. 2007 May;8(5):435-42. doi: 10.2217/14622416.8.5.435.
28	The redox state of cytochrome c modulates resistance to methotrexate in human MCF7 breast cancer cells. PLoS One. 2013 May 13;8(5):e63276. doi: 10.1371/journal.pone.0063276. Print 2013.
29	Glutathione S-transferase M1 inhibits dexamethasone-induced apoptosis in association with the suppression of Bim through dual mechanisms in a lymphoblastic leukemia cell line. Cancer Sci. 2010 Mar;101(3):767-73. doi: 10.1111/j.1349-7006.2009.01432.x. Epub 2010 Jan 7.
30	A study to survey susceptible genetic factors responsible for troglitazone-associated hepatotoxicity in Japanese patients with type 2 diabetes mellitus. Clin Pharmacol Ther. 2003 May;73(5):435-55. doi: 10.1016/s0009-9236(03)00014-6.
31	GSTM1, GSTT1, and GSTP1 genotypes and the genotoxicity of hydroquinone in human lymphocytes. Environ Mol Mutagen. 2004;43(4):258-64. doi: 10.1002/em.20015.
32	Glutathione-S-transferase genotypes and the adverse effects of azathioprine in young patients with inflammatory bowel disease. Inflamm Bowel Dis. 2007 Jan;13(1):57-64. doi: 10.1002/ibd.20004.
33	Association of polymorphism in alcohol dehydrogenase and interaction with other genetic risk factors with alcoholic liver cirrhosis. Drug Alcohol Depend. 2010 Jun 1;109(1-3):190-7. doi: 10.1016/j.drugalcdep.2010.01.010. Epub 2010 Feb 18.
34	Pharmacogenetics of outcome in children with acute lymphoblastic leukemia. Blood. 2005 Jun 15;105(12):4752-8. doi: 10.1182/blood-2004-11-4544. Epub 2005 Feb 15.
35	Familial aggregation of aspirin-induced urticaria and leukotriene C synthase allelic variant. Br J Dermatol. 2006 Feb;154(2):256-60. doi: 10.1111/j.1365-2133.2005.06851.x.
36	Role of human glutathione S-transferases in the inactivation of reactive metabolites of clozapine. Chem Res Toxicol. 2010 Sep 20;23(9):1467-76. doi: 10.1021/tx100131f.
37	Association between the GST genetic polymorphisms and methamphetamine abusers in the Japanese population. Leg Med (Tokyo). 2009 Apr;11 Suppl 1:S468-70. doi: 10.1016/j.legalmed.2009.01.095. Epub 2009 Feb 28.
38	A case control study of gene environmental interaction in fetal growth restriction with special reference to organochlorine pesticides. Eur J Obstet Gynecol Reprod Biol. 2012 Apr;161(2):163-9. doi: 10.1016/j.ejogrb.2012.01.008. Epub 2012 Feb 4.
39	Functional genetic variants of glutathione S-transferase protect against serum ascorbic acid deficiency. Am J Clin Nutr. 2009 Nov;90(5):1411-7. doi: 10.3945/ajcn.2009.28327. Epub 2009 Aug 26.
40	Customised in vitro model to detect human metabolism-dependent idiosyncratic drug-induced liver injury. Arch Toxicol. 2018 Jan;92(1):383-399. doi: 10.1007/s00204-017-2036-4. Epub 2017 Jul 31.
41	Effects of GSTM1/GSTT1 gene polymorphism and fruit & vegetable consumption on antioxidant biomarkers and cognitive function in the elderly: a community based cross-sectional study. PLoS One. 2014 Nov 24;9(11):e113588. doi: 10.1371/journal.pone.0113588. eCollection 2014.
42	Different Reactive Metabolites of Nevirapine Require Distinct Glutathione S-Transferase Isoforms for Bioinactivation. Chem Res Toxicol. 2016 Dec 19;29(12):2136-2144. doi: 10.1021/acs.chemrestox.6b00250. Epub 2016 Nov 28.
43	Glutathione S-transferase M1 and multidrug resistance protein 1 act in synergy to protect melanoma cells from vincristine effects. Mol Pharmacol. 2004 Apr;65(4):897-905. doi: 10.1124/mol.65.4.897.
44	Influence of glutathione S-transferase A1, P1, M1, T1 polymorphisms on oral busulfan pharmacokinetics in children with congenital hemoglobinopathies undergoing hematopoietic stem cell transplantation. Pediatr Blood Cancer. 2010 Dec 1;55(6):1172-9. doi: 10.1002/pbc.22739.
45	Marine n-3 fatty acid intake, glutathione S-transferase polymorphisms and breast cancer risk in post-menopausal Chinese women in Singapore. Carcinogenesis. 2004 Nov;25(11):2143-7. doi: 10.1093/carcin/bgh230. Epub 2004 Jul 15.
46	Cytochrome P450-mediated bioactivation of mefenamic acid to quinoneimine intermediates and inactivation by human glutathione S-transferases. Chem Res Toxicol. 2014 Dec 15;27(12):2071-81.
47	Reversible conjugation of isothiocyanates with glutathione catalyzed by human glutathione transferases. Biochem Biophys Res Commun. 1995 Jan 17;206(2):748-55. doi: 10.1006/bbrc.1995.1106.
48	Expression and polymorphism of glutathione S-transferase in human lungs: risk factors in smoking-related lung cancer. Carcinogenesis. 1995 Apr;16(4):707-11. doi: 10.1093/carcin/16.4.707.
49	Heterocyclic aromatic amine [HCA] intake and prostate cancer risk: effect modification by genetic variants. Nutr Cancer. 2012;64(5):704-13. doi: 10.1080/01635581.2012.678548. Epub 2012 May 7.
50	Glutathione-S-transferase M1, M3, T1 and P1 polymorphisms and susceptibility to non-small-cell lung cancer subtypes and hamartomas. Pharmacogenetics. 2001 Dec;11(9):757-64. doi: 10.1097/00008571-200112000-00003.
51	N-Acetyltransferase genotypes as modifiers of diisocyanate exposure-associated asthma risk. Pharmacogenetics. 2002 Apr;12(3):227-33. doi: 10.1097/00008571-200204000-00007.
52	Stereoselective conjugation of prostaglandin A2 and prostaglandin J2 with glutathione, catalyzed by the human glutathione S-transferases A1-1, A2-2, M1a-1a, and P1-1. Chem Res Toxicol. 1997 Mar;10(3):310-7. doi: 10.1021/tx9601770.