Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSTOX5G)

DOT Name Taste receptor type 2 member 13 (TAS2R13)
Synonyms T2R13; Taste receptor family B member 3; TRB3
Gene Name TAS2R13
Related Disease
Advanced cancer ( )
Acute myocardial infarction ( )
Barrett esophagus ( )
Breast cancer ( )
Cerebral infarction ( )
Craniosynostosis ( )
Diabetic kidney disease ( )
Esophageal squamous cell carcinoma ( )
Head and neck cancer ( )
Head and neck carcinoma ( )
Hepatocellular carcinoma ( )
Nephropathy ( )
Oral lichen planus ( )
Osteoarthritis ( )
Parkinson disease ( )
Polycystic ovarian syndrome ( )
Systemic sclerosis ( )
High blood pressure ( )
Lung adenocarcinoma ( )
Type-1 diabetes ( )
Breast carcinoma ( )
Hyperglycemia ( )
Neuroblastoma ( )
Non-insulin dependent diabetes ( )
UniProt ID
T2R13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF05296
Sequence
MESALPSIFTLVIIAEFIIGNLSNGFIVLINCIDWVSKRELSSVDKLLIILAISRIGLIW
EILVSWFLALHYLAIFVSGTGLRIMIFSWIVSNHFNLWLATIFSIFYLLKIASFSSPAFL
YLKWRVNKVILMILLGTLVFLFLNLIQINMHIKDWLDRYERNTTWNFSMSDFETFSVSVK
FTMTMFSLTPFTVAFISFLLLIFSLQKHLQKMQLNYKGHRDPRTKVHTNALKIVISFLLF
YASFFLCVLISWISELYQNTVIYMLCETIGVFSPSSHSFLLILGNAKLRQAFLLVAAKVW
AKR
Function
Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5.
Tissue Specificity Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
KEGG Pathway
Taste transduction (hsa04742 )
Reactome Pathway
Class C/3 (Metabotropic glutamate/pheromone receptors) (R-HSA-420499 )
Sensory perception of sweet, bitter, and umami (glutamate) taste (R-HSA-9717207 )
G alpha (i) signalling events (R-HSA-418594 )

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Definitive Biomarker [1]
Acute myocardial infarction DISE3HTG Strong Altered Expression [2]
Barrett esophagus DIS416Y7 Strong Altered Expression [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Cerebral infarction DISR1WNP Strong Altered Expression [5]
Craniosynostosis DIS6J405 Strong Genetic Variation [6]
Diabetic kidney disease DISJMWEY Strong Biomarker [7]
Esophageal squamous cell carcinoma DIS5N2GV Strong Genetic Variation [8]
Head and neck cancer DISBPSQZ Strong Genetic Variation [9]
Head and neck carcinoma DISOU1DS Strong Genetic Variation [9]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [10]
Nephropathy DISXWP4P Strong Genetic Variation [7]
Oral lichen planus DISVEAJA Strong Altered Expression [11]
Osteoarthritis DIS05URM Strong Altered Expression [12]
Parkinson disease DISQVHKL Strong Altered Expression [13]
Polycystic ovarian syndrome DISZ2BNG Strong Genetic Variation [14]
Systemic sclerosis DISF44L6 Strong Biomarker [15]
High blood pressure DISY2OHH moderate Genetic Variation [16]
Lung adenocarcinoma DISD51WR moderate Altered Expression [17]
Type-1 diabetes DIS7HLUB Disputed Altered Expression [18]
Breast carcinoma DIS2UE88 Limited Biomarker [4]
Hyperglycemia DIS0BZB5 Limited Altered Expression [19]
Neuroblastoma DISVZBI4 Limited Altered Expression [20]
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 24 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Taste receptor type 2 member 13 (TAS2R13). [22]
------------------------------------------------------------------------------------

References

1 Cellular stress induces TRB3/USP9x-dependent Notch activation in cancer.Oncogene. 2017 Feb 23;36(8):1048-1057. doi: 10.1038/onc.2016.276. Epub 2016 Sep 5.
2 Atorvastatin alleviates cardiomyocyte apoptosis by suppressing TRB3 induced by acute myocardial infarction and hypoxia.J Formos Med Assoc. 2017 May;116(5):388-397. doi: 10.1016/j.jfma.2016.07.010. Epub 2016 Sep 17.
3 An integrative genomic approach in oesophageal cells identifies TRB3 as a bile acid responsive gene, downregulated in Barrett's oesophagus, which regulates NF-kappaB activation and cytokine levels.Carcinogenesis. 2010 May;31(5):936-45. doi: 10.1093/carcin/bgq036. Epub 2010 Feb 5.
4 High throughput kinase inhibitor screens reveal TRB3 and MAPK-ERK/TGF pathways as fundamental Notch regulators in breast cancer.Proc Natl Acad Sci U S A. 2013 Jan 29;110(5):1714-9. doi: 10.1073/pnas.1214014110. Epub 2013 Jan 14.
5 Downregulation of TRB3 protects neurons against apoptosis induced by global cerebral ischemia and reperfusion injury in rats.Neuroscience. 2017 Sep 30;360:118-127. doi: 10.1016/j.neuroscience.2017.07.062. Epub 2017 Aug 4.
6 Genetic variations in taste receptors are associated with chronic rhinosinusitis: a replication study.Int Forum Allergy Rhinol. 2014 Mar;4(3):200-6. doi: 10.1002/alr.21275. Epub 2014 Jan 10.
7 Silencing of TRB3 Ameliorates Diabetic Tubule Interstitial Nephropathy via PI3K/AKT Signaling in Rats.Med Sci Monit. 2017 Jun 10;23:2816-2824. doi: 10.12659/msm.902581.
8 Pathway, in silico and tissue-specific expression quantitative analyses of oesophageal squamous cell carcinoma genome-wide association studies data.Int J Epidemiol. 2016 Feb;45(1):206-20. doi: 10.1093/ije/dyv294. Epub 2015 Dec 3.
9 Variation in the gene TAS2R13 is associated with differences in alcohol consumption in patients with head and neck cancer.Chem Senses. 2012 Oct;37(8):737-44. doi: 10.1093/chemse/bjs063. Epub 2012 Jul 23.
10 TRB3 reverses chemotherapy resistance and mediates crosstalk between endoplasmic reticulum stress and AKT signaling pathways in MHCC97H human hepatocellular carcinoma cells.Oncol Lett. 2018 Jan;15(1):1343-1349. doi: 10.3892/ol.2017.7361. Epub 2017 Nov 8.
11 Aberrant IGF1-PI3K/AKT/MTOR signaling pathway regulates the local immunity of oral lichen planus.Immunobiology. 2019 May;224(3):455-461. doi: 10.1016/j.imbio.2019.01.004. Epub 2019 Feb 10.
12 Increased expression of the Akt/PKB inhibitor TRB3 in osteoarthritic chondrocytes inhibits insulin-like growth factor 1-mediated cell survival and proteoglycan synthesis.Arthritis Rheum. 2009 Feb;60(2):492-500. doi: 10.1002/art.24225.
13 Autophagy Activation Is Involved in Acidic Fibroblast Growth Factor Ameliorating Parkinson's Disease via Regulating Tribbles Homologue 3.Front Pharmacol. 2019 Dec 2;10:1428. doi: 10.3389/fphar.2019.01428. eCollection 2019.
14 Association of TRB3 Q84R polymorphism with polycystic ovary syndrome in Chinese women.Reprod Biol Endocrinol. 2011 Apr 14;9:46. doi: 10.1186/1477-7827-9-46.
15 Tribbles homologue 3 stimulates canonical TGF- signalling to regulate fibroblast activation and tissue fibrosis.Ann Rheum Dis. 2016 Mar;75(3):609-16. doi: 10.1136/annrheumdis-2014-206234. Epub 2015 Jan 20.
16 Molecular mechanisms in microRNA-mediated TRB3 gene and hypertension left ventricular hypertrophy.Exp Ther Med. 2017 May;13(5):1907-1911. doi: 10.3892/etm.2017.4220. Epub 2017 Mar 10.
17 TRB3 interacts with ERK and JNK and contributes to the proliferation, apoptosis, and migration of lung adenocarcinoma cells.J Cell Physiol. 2020 Jan;235(1):538-547. doi: 10.1002/jcp.28993. Epub 2019 Jun 29.
18 Resveratrol attenuates testicular apoptosis in type 1 diabetic mice: Role of Akt-mediated Nrf2 activation and p62-dependent Keap1 degradation.Redox Biol. 2018 Apr;14:609-617. doi: 10.1016/j.redox.2017.11.007. Epub 2017 Nov 8.
19 TRB3: a tribbles homolog that inhibits Akt/PKB activation by insulin in liver.Science. 2003 Jun 6;300(5625):1574-7. doi: 10.1126/science.1079817.
20 Matrine Inhibits Neuroblastoma Cell Proliferation and Migration by Enhancing Tribbles 3 Expression.Oncol Res. 2018 Aug 23;26(7):1133-1142. doi: 10.3727/096504018X15168461629558. Epub 2018 Jan 31.
21 Association of TRB3 gene Q84R polymorphism with type 2 diabetes mellitus in Chinese population.Endocrine. 2009 Jun;35(3):414-9. doi: 10.1007/s12020-009-9162-6. Epub 2009 Mar 17.
22 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.