Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUS7RM2)

• DOT Name: Cysteine and glycine-rich protein 1 (CSRP1)
• Synonyms: Cysteine-rich protein 1; CRP; CRP1; Epididymis luminal protein 141; HEL-141
• Gene Name: CSRP1
• Related Disease:
  Acute myocardial infarction
  Advanced cancer
  Atypical endometrial hyperplasia
  Bipolar disorder
  Breast adenocarcinoma
  Cervical cancer
  Cervical carcinoma
  Colon cancer
  Colon carcinoma
  Esophageal squamous cell carcinoma
  Hepatocellular carcinoma
  Neoplasm
  Prostate neoplasm
  Pulmonary fibrosis
  Bacterial infection
  Colorectal carcinoma
  Malignant mesothelioma
  Prostate cancer
  Prostate carcinoma
• UniProt ID: CSRP1_HUMAN
• Pfam ID: PF00412
• Sequence:
  MPNWGGGKKCGVCQKTVYFAEEVQCEGNSFHKSCFLCMVCKKNLDSTTVAVHGEEIYCKS
  CYGKKYGPKGYGYGQGAGTLSTDKGESLGIKHEEAPGHRPTTNPNASKFAQKIGGSERCP
  RCSQAVYAAEKVIGAGKSWHKACFRCAKCGKGLESTTLADKDGEIYCKGCYAKNFGPKGF
  GFGQGAGALVHSE
• Function: Could play a role in neuronal development.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway: MTF1 activates gene expression (R-HSA-5660489)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myocardial infarction	DISE3HTG	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Atypical endometrial hyperplasia	DIS2POYG	Strong	Biomarker	[3]
Bipolar disorder	DISAM7J2	Strong	Biomarker	[4]
Breast adenocarcinoma	DISMPHJ0	Strong	Biomarker	[5]
Cervical cancer	DISFSHPF	Strong	Biomarker	[6]
Cervical carcinoma	DIST4S00	Strong	Biomarker	[6]
Colon cancer	DISVC52G	Strong	Genetic Variation	[7]
Colon carcinoma	DISJYKUO	Strong	Genetic Variation	[7]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[8]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Prostate neoplasm	DISHDKGQ	Strong	Biomarker	[11]
Pulmonary fibrosis	DISQKVLA	Strong	Altered Expression	[12]
Bacterial infection	DIS5QJ9S	moderate	Biomarker	[13]
Colorectal carcinoma	DIS5PYL0	Limited	Biomarker	[10]
Malignant mesothelioma	DISTHJGH	Limited	Biomarker	[14]
Prostate cancer	DISF190Y	Limited	Biomarker	[15]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[15]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Cysteine and glycine-rich protein 1 (CSRP1) affects the response to substance of Fluorouracil.	[38]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Cysteine and glycine-rich protein 1 (CSRP1).	[16]
Quercetin	DM3NC4M	Approved	Quercetin increases the phosphorylation of Cysteine and glycine-rich protein 1 (CSRP1).	[24]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Cysteine and glycine-rich protein 1 (CSRP1).	[32]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[20]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[21]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[22]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[23]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[25]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[26]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[28]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[18]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[29]
Tocopherol	DMBIJZ6	Phase 2	Tocopherol increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[30]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[33]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[34]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[35]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[36]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Cysteine and glycine-rich protein 1 (CSRP1).	[37]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Cysteine and glycine-rich protein 1 (CSRP1).	[27]

References

• [1] Selenoprotein P in Myocardial Infarction With Cardiogenic Shock.Shock. 2020 Jan;53(1):58-62. doi: 10.1097/SHK.0000000000001342.
• [2] Methylation status of genes upregulated by demethylating agent 5-aza-2'-deoxycytidine in hepatocellular carcinoma.Oncology. 2006;71(1-2):77-85. doi: 10.1159/000100475. Epub 2007 Mar 6.
• [3] Hormonally active doses of isoflavone aglycones promote mammary and endometrial carcinogenesis and alter the molecular tumor environment in Donryu rats.Toxicol Sci. 2012 Mar;126(1):39-51. doi: 10.1093/toxsci/kfs016. Epub 2012 Jan 16.
• [4] Peripheral PDLIM5 expression in bipolar disorder and the effect of olanzapine administration.BMC Med Genet. 2012 Oct 2;13:91. doi: 10.1186/1471-2350-13-91.
• [5] The LIM domain protein FHL1C interacts with tight junction protein ZO-1 contributing to the epithelial-mesenchymal transition (EMT) of a breast adenocarcinoma cell line.Gene. 2014 Jun 1;542(2):182-9. doi: 10.1016/j.gene.2014.03.036. Epub 2014 Mar 19.
• [6] AJUBA increases the cisplatin resistance through hippo pathway in cervical cancer.Gene. 2018 Feb 20;644:148-154. doi: 10.1016/j.gene.2017.11.017. Epub 2017 Nov 7.
• [7] Hybrid Method Based on Information Gain and Support Vector Machine for Gene Selection in Cancer Classification.Genomics Proteomics Bioinformatics. 2017 Dec;15(6):389-395. doi: 10.1016/j.gpb.2017.08.002. Epub 2017 Dec 12.
• [8] The LIM domain protein, CRIP2, promotes apoptosis in esophageal squamous cell carcinoma.Cancer Lett. 2012 Mar;316(1):39-45. doi: 10.1016/j.canlet.2011.10.020. Epub 2011 Oct 20.
• [9] C-reactive protein is an independent predictor for hepatocellular carcinoma recurrence after liver transplantation.PLoS One. 2019 May 29;14(5):e0216677. doi: 10.1371/journal.pone.0216677. eCollection 2019.
• [10] Screening of tumor suppressor genes on 1q31.1-32.1 in Chinese patients with sporadic colorectal cancer.Chin Med J (Engl). 2008 Dec 20;121(24):2479-86.
• [11] Global analysis of differentially expressed genes in androgen-independent prostate cancer.Prostate Cancer Prostatic Dis. 2007;10(2):167-74. doi: 10.1038/sj.pcan.4500933. Epub 2007 Jan 2.
• [12] Cysteine-rich protein 1 is regulated by transforming growth factor-1 and expressed in lung fibrosis.J Cell Physiol. 2012 Jun;227(6):2605-12. doi: 10.1002/jcp.23000.
• [13] Neutralization of viral infectivity by zebrafish c-reactive protein isoforms.Mol Immunol. 2017 Nov;91:145-155. doi: 10.1016/j.molimm.2017.09.005. Epub 2017 Sep 12.
• [14] LIM-domain protein AJUBA suppresses malignant mesothelioma cell proliferation via Hippo signaling cascade.Oncogene. 2015 Jan 2;34(1):73-83. doi: 10.1038/onc.2013.528. Epub 2013 Dec 16.
• [15] Multivariate gene expression analysis reveals functional connectivity changes between normal/tumoral prostates.BMC Syst Biol. 2008 Dec 5;2:106. doi: 10.1186/1752-0509-2-106.
• [16] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [17] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [18] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [19] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [22] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [23] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [24] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [25] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [26] Aberrantly expressed genes in HaCaT keratinocytes chronically exposed to arsenic trioxide. Biomark Insights. 2011 Feb 8;6:7-16.
• [27] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Quantitative proteomics and transcriptomics addressing the estrogen receptor subtype-mediated effects in T47D breast cancer cells exposed to the phytoestrogen genistein. Mol Cell Proteomics. 2011 Jan;10(1):M110.002170.
• [30] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [31] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [32] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Environmental pollutant induced cellular injury is reflected in exosomes from placental explants. Placenta. 2020 Jan 1;89:42-49. doi: 10.1016/j.placenta.2019.10.008. Epub 2019 Oct 17.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [37] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [38] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.