Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUZ3U9Z)

• DOT Name: Cdc42 effector protein 3 (CDC42EP3)
• Synonyms: Binder of Rho GTPases 2; MSE55-related Cdc42-binding protein
• Gene Name: CDC42EP3
• Related Disease:
  Neoplasm
  Uveal Melanoma
  Bladder cancer
  Breast cancer
  Esophageal squamous cell carcinoma
  Lung cancer
  Lung carcinoma
  Rheumatoid arthritis
  Schizophrenia
  Transitional cell carcinoma
  Urinary bladder cancer
  Urinary bladder neoplasm
  Urothelial carcinoma
  Squamous cell carcinoma
  Adenocarcinoma
• UniProt ID: BORG2_HUMAN
• Pfam ID: PF14957 ; PF00786
• Sequence:
  MPAKTPIYLKAANNKKGKKFKLRDILSPDMISPPLGDFRHTIHIGKEGQHDVFGDISFLQ
  GNYELLPGNQEKAHLGQFPGHNEFFRANSTSDSVFTETPSPVLKNAISLPTIGGSQALML
  PLLSPVTFNSKQESFGPAKLPRLSCEPVMEEKAQEKSSLLENGTVHQGDTSWGSSGSASQ
  SSQGRDSHSSSLSEQYPDWPAEDMFDHPTPCELIKGKTKSEESLSDLTGSLLSLQLDLGP
  SLLDEVLNVMDKNK
• Function: Probably involved in the organization of the actin cytoskeleton. May act downstream of CDC42 to induce actin filament assembly leading to cell shape changes. Induces pseudopodia formation in fibroblasts.
• Tissue Specificity: Highly expressed in the heart and weakly in the brain.
• Reactome Pathway:
  CDC42 GTPase cycle (R-HSA-9013148)
  RHOQ GTPase cycle (R-HSA-9013406)
  MAPK6/MAPK4 signaling (R-HSA-5687128)

Molecular Interaction Atlas (MIA) of This DOT

15 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neoplasm	DISZKGEW	Definitive	Biomarker	[1]
Uveal Melanoma	DISA7ZGL	Definitive	Genetic Variation	[2]
Bladder cancer	DISUHNM0	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[5]
Lung cancer	DISCM4YA	Strong	Biomarker	[6]
Lung carcinoma	DISTR26C	Strong	Biomarker	[6]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[7]
Schizophrenia	DISSRV2N	Strong	Biomarker	[8]
Transitional cell carcinoma	DISWVVDR	Strong	Biomarker	[9]
Urinary bladder cancer	DISDV4T7	Strong	Biomarker	[3]
Urinary bladder neoplasm	DIS7HACE	Strong	Biomarker	[3]
Urothelial carcinoma	DISRTNTN	Strong	Biomarker	[9]
Squamous cell carcinoma	DISQVIFL	moderate	Biomarker	[10]
Adenocarcinoma	DIS3IHTY	Limited	Biomarker	[11]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[12]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[13]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[14]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[15]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[16]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[17]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[18]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[18]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Cdc42 effector protein 3 (CDC42EP3).	[19]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[20]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Cdc42 effector protein 3 (CDC42EP3).	[21]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[22]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[23]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol affects the expression of Cdc42 effector protein 3 (CDC42EP3).	[24]
Melphalan	DMOLNHF	Approved	Melphalan decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[25]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[26]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[27]
Genistein	DM0JETC	Phase 2/3	Genistein affects the expression of Cdc42 effector protein 3 (CDC42EP3).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[29]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cdc42 effector protein 3 (CDC42EP3).	[31]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Cdc42 effector protein 3 (CDC42EP3).	[33]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Cdc42 effector protein 3 (CDC42EP3).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cdc42 effector protein 3 (CDC42EP3).	[30]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Cdc42 effector protein 3 (CDC42EP3).	[34]

References

• [1] Chromosome 3 status in uveal melanoma: a comparison of fluorescence in situ hybridization and single-nucleotide polymorphism array.Invest Ophthalmol Vis Sci. 2012 Jun 5;53(7):3331-9. doi: 10.1167/iovs.11-9027.
• [2] Genomic microarray analysis on formalin-fixed paraffin-embedded material for uveal melanoma prognostication.Cancer Genet. 2014 Jul-Aug;207(7-8):306-15. doi: 10.1016/j.cancergen.2014.08.005. Epub 2014 Aug 29.
• [3] Automated quantification of FISH signals in urinary cells enables the assessment of chromosomal aberration patterns characteristic for bladder cancer.Biochem Biophys Res Commun. 2014 Jun 13;448(4):467-72. doi: 10.1016/j.bbrc.2014.04.137. Epub 2014 May 4.
• [4] FGD5 amplification in breast cancer patients is associated with tumour proliferation and a poorer prognosis.Breast Cancer Res Treat. 2017 Apr;162(2):243-253. doi: 10.1007/s10549-017-4125-8. Epub 2017 Jan 25.
• [5] Chromosomal aneuploidies and combinational fluorescence in situ hybridization probe panels are useful for predicting prognosis for esophageal squamous cell carcinoma.J Gastroenterol. 2015 Feb;50(2):155-66. doi: 10.1007/s00535-014-0961-z. Epub 2014 May 11.
• [6] Recurrent genomic gains in preinvasive lesions as a biomarker of risk for lung cancer.PLoS One. 2009 Jun 9;4(6):e5611. doi: 10.1371/journal.pone.0005611.
• [7] Studying the effects of haplotype partitioning methods on the RA-associated genomic results from the North American Rheumatoid Arthritis Consortium (NARAC) dataset.J Adv Res. 2019 Jan 18;18:113-126. doi: 10.1016/j.jare.2019.01.006. eCollection 2019 Jul.
• [8] Altered cortical CDC42 signaling pathways in schizophrenia: implications for dendritic spine deficits.Biol Psychiatry. 2010 Jul 1;68(1):25-32. doi: 10.1016/j.biopsych.2010.02.016. Epub 2010 Apr 10.
• [9] The development of a multitarget, multicolor fluorescence in situ hybridization assay for the detection of urothelial carcinoma in urine.J Mol Diagn. 2000 Aug;2(3):116-23. doi: 10.1016/S1525-1578(10)60625-3.
• [10] Analysis of the chromosomal aneuploidy by interphase fluorescence in situ hybridization (FISH) in Squamous cell carcinoma of the cervix in Jammu region of J and K state.J Cancer Res Ther. 2014 Apr-Jun;10(2):317-23. doi: 10.4103/0973-1482.136612.
• [11] A potential probe set of fluorescence in situ hybridization for detection of lung cancer in bronchial brushing specimens.J Cancer Res Clin Oncol. 2012 Sep;138(9):1541-9. doi: 10.1007/s00432-012-1232-0. Epub 2012 Apr 27.
• [12] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [13] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [14] Systems analysis of transcriptome and proteome in retinoic acid/arsenic trioxide-induced cell differentiation/apoptosis of promyelocytic leukemia. Proc Natl Acad Sci U S A. 2005 May 24;102(21):7653-8.
• [15] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [16] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [17] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [18] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [19] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [20] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [21] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [22] Progesterone regulation of implantation-related genes: new insights into the role of oestrogen. Cell Mol Life Sci. 2007 Apr;64(7-8):1009-32.
• [23] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [24] Dose- and time-dependent transcriptional response of Ishikawa cells exposed to genistein. Toxicol Sci. 2016 May;151(1):71-87.
• [25] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [26] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [27] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [28] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [29] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [30] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [31] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [32] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [33] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [34] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.