Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTV0YRI8)

DOT Name HLA class I histocompatibility antigen protein P5 (HCP5)
Synonyms HLA complex protein P5; Protein P5-1
Gene Name HCP5
Related Disease
Bone osteosarcoma ( )
Osteosarcoma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid gland follicular carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid gland undifferentiated (anaplastic) carcinoma ( )
Thyroid tumor ( )
Acquired immune deficiency syndrome ( )
Cervical cancer ( )
Cervical carcinoma ( )
Chronic kidney disease ( )
Cutaneous melanoma ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
HIV infectious disease ( )
Leukocyte adhesion deficiency type 1 ( )
Lung adenocarcinoma ( )
Melanoma ( )
Multiple sclerosis ( )
Neoplasm ( )
Pemphigus vulgaris ( )
Psoriasis ( )
Psoriatic arthritis ( )
Rheumatoid arthritis ( )
Schizophrenia ( )
Stevens-Johnson syndrome ( )
Systemic lupus erythematosus ( )
Toxic epidermal necrolysis ( )
Type-1 diabetes ( )
Colon cancer ( )
Colon carcinoma ( )
Herpes zoster ( )
Nasopharyngeal carcinoma ( )
Small-cell lung cancer ( )
Triple negative breast cancer ( )
Advanced cancer ( )
Carpal tunnel syndrome ( )
Graves disease ( )
Lung carcinoma ( )
Lung squamous cell carcinoma ( )
Myositis disease ( )
Polymyositis ( )
Squamous cell carcinoma ( )
UniProt ID
HCP5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MLLRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQG
DPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVSGHILSNSPVAAVMCSSM
GTHLSPFKGTLL
Tissue Specificity Expressed in lymphoid tissues; Detected in spleen as well as in B-cell lines, NK cell lines and activated lymphocytes.

Molecular Interaction Atlas (MIA) of This DOT

44 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bone osteosarcoma DIST1004 Definitive Altered Expression [1]
Osteosarcoma DISLQ7E2 Definitive Altered Expression [1]
Thyroid cancer DIS3VLDH Definitive Biomarker [2]
Thyroid gland carcinoma DISMNGZ0 Definitive Biomarker [2]
Thyroid gland follicular carcinoma DISFK2QT Definitive Biomarker [2]
Thyroid gland papillary carcinoma DIS48YMM Definitive Biomarker [2]
Thyroid gland undifferentiated (anaplastic) carcinoma DISYBB1W Definitive Altered Expression [2]
Thyroid tumor DISLVKMD Definitive Biomarker [2]
Acquired immune deficiency syndrome DISL5UOX Strong Genetic Variation [3]
Cervical cancer DISFSHPF Strong Altered Expression [4]
Cervical carcinoma DIST4S00 Strong Altered Expression [4]
Chronic kidney disease DISW82R7 Strong Biomarker [5]
Cutaneous melanoma DIS3MMH9 Strong Altered Expression [6]
Hepatitis C virus infection DISQ0M8R Strong Genetic Variation [7]
Hepatocellular carcinoma DIS0J828 Strong Genetic Variation [7]
HIV infectious disease DISO97HC Strong Genetic Variation [8]
Leukocyte adhesion deficiency type 1 DISA1J7W Strong Altered Expression [9]
Lung adenocarcinoma DISD51WR Strong Altered Expression [10]
Melanoma DIS1RRCY Strong Altered Expression [6]
Multiple sclerosis DISB2WZI Strong Genetic Variation [11]
Neoplasm DISZKGEW Strong Altered Expression [12]
Pemphigus vulgaris DISENR62 Strong Genetic Variation [13]
Psoriasis DIS59VMN Strong Genetic Variation [14]
Psoriatic arthritis DISLWTG2 Strong Genetic Variation [15]
Rheumatoid arthritis DISTSB4J Strong Genetic Variation [16]
Schizophrenia DISSRV2N Strong Genetic Variation [17]
Stevens-Johnson syndrome DISZG4YX Strong Genetic Variation [18]
Systemic lupus erythematosus DISI1SZ7 Strong Genetic Variation [19]
Toxic epidermal necrolysis DISIWPFR Strong Genetic Variation [14]
Type-1 diabetes DIS7HLUB Strong Genetic Variation [20]
Colon cancer DISVC52G moderate Altered Expression [12]
Colon carcinoma DISJYKUO moderate Altered Expression [12]
Herpes zoster DISNSMNY moderate Genetic Variation [21]
Nasopharyngeal carcinoma DISAOTQ0 moderate Genetic Variation [22]
Small-cell lung cancer DISK3LZD moderate Biomarker [23]
Triple negative breast cancer DISAMG6N moderate Altered Expression [24]
Advanced cancer DISAT1Z9 Limited Altered Expression [6]
Carpal tunnel syndrome DISHQ3BE Limited Genetic Variation [25]
Graves disease DISU4KOQ Limited Genetic Variation [26]
Lung carcinoma DISTR26C Limited Genetic Variation [27]
Lung squamous cell carcinoma DISXPIBD Limited Genetic Variation [27]
Myositis disease DISCIXF0 Limited Genetic Variation [28]
Polymyositis DIS5DHFP Limited Genetic Variation [29]
Squamous cell carcinoma DISQVIFL Limited Altered Expression [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 44 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 4 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Allopurinol DMLPAOB Approved HLA class I histocompatibility antigen protein P5 (HCP5) increases the subcutaneous tissue disorders ADR of Allopurinol. [31]
Abacavir DMMN36E Approved HLA class I histocompatibility antigen protein P5 (HCP5) increases the Hypersensitivity ADR of Abacavir. [32]
Flucloxacillin DMNUWST Approved HLA class I histocompatibility antigen protein P5 (HCP5) increases the Liver injury ADR of Flucloxacillin. [33]
Pazopanib DMF57DM Approved HLA class I histocompatibility antigen protein P5 (HCP5) increases the Hepatotoxicty ADR of Pazopanib. [34]
------------------------------------------------------------------------------------

References

1 SP1-induced upregulation of long non-coding RNA HCP5 promotes the development of osteosarcoma.Pathol Res Pract. 2019 Mar;215(3):439-445. doi: 10.1016/j.prp.2018.12.006. Epub 2018 Dec 10.
2 Knockdown of HCP5 exerts tumor-suppressive functions by up-regulating tumor suppressor miR-128-3p in anaplastic thyroid cancer.Biomed Pharmacother. 2019 Aug;116:108966. doi: 10.1016/j.biopha.2019.108966. Epub 2019 May 16.
3 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).J Infect Dis. 2009 Feb 1;199(3):419-26. doi: 10.1086/596067.
4 LncRNA HCP5 promotes the development of cervical cancer by regulating MACC1 via suppression of microRNA-15a.Eur Rev Med Pharmacol Sci. 2018 Aug;22(15):4812-4819. doi: 10.26355/eurrev_201808_15616.
5 Screening potential prognostic biomarkers of long non-coding RNAs for predicting the risk of chronic kidney disease.Braz J Med Biol Res. 2019 Nov 7;52(11):e8333. doi: 10.1590/1414-431X20198333. eCollection 2019.
6 Long noncoding RNA HCP5 suppresses skin cutaneous melanoma development by regulating RARRES3 gene expression via sponging miR-12.Onco Targets Ther. 2019 Aug 12;12:6323-6335. doi: 10.2147/OTT.S195796. eCollection 2019.
7 Polymorphisms in MICA, but not in DEPDC5, HCP5 or PNPLA3, are associated with chronic hepatitis C-related hepatocellular carcinoma.Sci Rep. 2017 Sep 19;7(1):11912. doi: 10.1038/s41598-017-10363-5.
8 Rapid HCP5 single-nucleotide polymorphism genotyping: a simple allele-specific PCR method for prediction of hypersensitivity reaction to Abacavir.Clin Chim Acta. 2011 Jul 15;412(15-16):1382-4. doi: 10.1016/j.cca.2011.04.010. Epub 2011 Apr 14.
9 Revealing potential long non-coding RNA biomarkers in lung adenocarcinoma using long non-coding RNA-mediated competitive endogenous RNA network.Braz J Med Biol Res. 2017 Aug 7;50(9):e6297. doi: 10.1590/1414-431X20176297.
10 HCP5 is a SMAD3-responsive long non-coding RNA that promotes lung adenocarcinoma metastasis via miR-203/SNAI axis.Theranostics. 2019 Apr 13;9(9):2460-2474. doi: 10.7150/thno.31097. eCollection 2019.
11 Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
12 HCP5 promotes colon cancer development by activating AP1G1 via PI3K/AKT pathway.Eur Rev Med Pharmacol Sci. 2019 Apr;23(7):2786-2793. doi: 10.26355/eurrev_201904_17553.
13 Population-specific association between a polymorphic variant in ST18, encoding a pro-apoptotic molecule, and pemphigus vulgaris.J Invest Dermatol. 2012 Jul;132(7):1798-805. doi: 10.1038/jid.2012.46. Epub 2012 Mar 22.
14 Genome-wide DNA methylation analysis in ankylosing spondylitis identifies HLA-B*27 dependent and independent DNA methylation changes in whole blood.J Autoimmun. 2019 Aug;102:126-132. doi: 10.1016/j.jaut.2019.04.022. Epub 2019 May 23.
15 Genomic dissection of population substructure of Han Chinese and its implication in association studies.Am J Hum Genet. 2009 Dec;85(6):762-74. doi: 10.1016/j.ajhg.2009.10.015.
16 REL, encoding a member of the NF-kappaB family of transcription factors, is a newly defined risk locus for rheumatoid arthritis.Nat Genet. 2009 Jul;41(7):820-3. doi: 10.1038/ng.395. Epub 2009 Jun 7.
17 Meta-analysis of GWAS of over 16,000 individuals with autism spectrum disorder highlights a novel locus at 10q24.32 and a significant overlap with schizophrenia.Mol Autism. 2017 May 22;8:21. doi: 10.1186/s13229-017-0137-9. eCollection 2017.
18 HCP5 genetic variant (RS3099844) contributes to Nevirapine-induced Stevens Johnsons Syndrome/Toxic Epidermal Necrolysis susceptibility in a population from Mozambique.Eur J Clin Pharmacol. 2014 Mar;70(3):275-8. doi: 10.1007/s00228-013-1622-5. Epub 2013 Dec 10.
19 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.Genes Immun. 2014 Sep;15(6):347-54. doi: 10.1038/gene.2014.23. Epub 2014 May 29.
20 A genome-wide association study identifies KIAA0350 as a type 1 diabetes gene.Nature. 2007 Aug 2;448(7153):591-4. doi: 10.1038/nature06010. Epub 2007 Jul 15.
21 The eMERGE genotype set of 83,717 subjects imputed to ~40million variants genome wide and association with the herpes zoster medical record phenotype.Genet Epidemiol. 2019 Feb;43(1):63-81. doi: 10.1002/gepi.22167. Epub 2018 Oct 8.
22 A gender-specific association of CNV at 6p21.3 with NPC susceptibility.Hum Mol Genet. 2011 Jul 15;20(14):2889-96. doi: 10.1093/hmg/ddr191. Epub 2011 May 2.
23 Identification of candidate genes or microRNAs associated with the lymph node metastasis of SCLC.Cancer Cell Int. 2018 Oct 19;18:161. doi: 10.1186/s12935-018-0653-5. eCollection 2018.
24 Long noncoding RNA HCP5 contributes to cisplatin resistance in human triple-negative breast cancer via regulation of PTEN expression.Biomed Pharmacother. 2019 Jul;115:108869. doi: 10.1016/j.biopha.2019.108869. Epub 2019 Apr 24.
25 A genome-wide association analysis identifies 16 novel susceptibility loci for carpal tunnel syndrome.Nat Commun. 2019 Mar 4;10(1):1030. doi: 10.1038/s41467-019-08993-6.
26 Paediatric-onset and adult-onset Graves' disease share multiple genetic risk factors.Clin Endocrinol (Oxf). 2019 Feb;90(2):320-327. doi: 10.1111/cen.13887. Epub 2018 Nov 15.
27 Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
28 Genome-wide association study identifies HLA 8.1 ancestral haplotype alleles as major genetic risk factors for myositis phenotypes.Genes Immun. 2015 Oct;16(7):470-80. doi: 10.1038/gene.2015.28. Epub 2015 Aug 20.
29 Dense genotyping of immune-related loci in idiopathic inflammatory myopathies confirms HLA alleles as the strongest genetic risk factor and suggests different genetic background for major clinical subgroups.Ann Rheum Dis. 2016 Aug;75(8):1558-66. doi: 10.1136/annrheumdis-2015-208119. Epub 2015 Sep 11.
30 Long Non-Coding RNA HCP5 Facilitates Cell Invasion And Epithelial-Mesenchymal Transition In Oral Squamous Cell Carcinoma By miR-140-5p/SOX4 Axis.Cancer Manag Res. 2019 Dec 12;11:10455-10462. doi: 10.2147/CMAR.S230324. eCollection 2019.
31 Clinical Pharmacogenetics Implementation Consortium guidelines for human leukocyte antigen-B genotype and allopurinol dosing. Clin Pharmacol Ther. 2013 Feb;93(2):153-8. doi: 10.1038/clpt.2012.209. Epub 2012 Oct 17.
32 The HCP5 single-nucleotide polymorphism: a simple screening tool for prediction of hypersensitivity reaction to abacavir. J Infect Dis. 2008 Sep 15;198(6):864-7. doi: 10.1086/591184.
33 HLA-B*5701 genotype is a major determinant of drug-induced liver injury due to flucloxacillin. Nat Genet. 2009 Jul;41(7):816-9. doi: 10.1038/ng.379. Epub 2009 May 31.
34 HLA-B*57:01 Confers Susceptibility to Pazopanib-Associated Liver Injury in Patients with Cancer. Clin Cancer Res. 2016 Mar 15;22(6):1371-7. doi: 10.1158/1078-0432.CCR-15-2044. Epub 2015 Nov 6.