Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTXJY54C)

• DOT Name: Anillin (ANLN)
• Gene Name: ANLN
• Related Disease:
  Bladder transitional cell carcinoma
  Adult respiratory distress syndrome
  Branchiootic syndrome
  Breast neoplasm
  Bronchiolitis obliterans syndrome
  Focal segmental glomerulosclerosis
  Focal segmental glomerulosclerosis 8
  Gastric cancer
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Nephropathy
  Nephrotic syndrome, type 2
  Pancreatitis
  Polycystic ovarian syndrome
  Schizophrenia
  Stomach cancer
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Methicillin-resistant staphylococci infection
  Nasopharyngeal carcinoma
  Neoplasm
  Familial idiopathic steroid-resistant nephrotic syndrome
  Lung cancer
  Lung carcinoma
  Non-small-cell lung cancer
  Castration-resistant prostate carcinoma
  Pancreatic cancer
  Pancreatic ductal carcinoma
• UniProt ID: ANLN_HUMAN
• PDB ID: 2Y7B; 4XH3; 4XOI
• Pfam ID: PF08174 ; PF16018 ; PF00169
• Sequence:
  MDPFTEKLLERTRARRENLQRKMAERPTAAPRSMTHAKRARQPLSEASNQQPLSGGEEKS
  CTKPSPSKKRCSDNTEVEVSNLENKQPVESTSAKSCSPSPVSPQVQPQAADTISDSVAVP
  ASLLGMRRGLNSRLEATAASSVKTRMQKLAEQRRRWDNDDMTDDIPESSLFSPMPSEEKA
  ASPPRPLLSNASATPVGRRGRLANLAATICSWEDDVNHSFAKQNSVQEQPGTACLSKFSS
  ASGASARINSSSVKQEATFCSQRDGDASLNKALSSSADDASLVNASISSSVKATSPVKST
  TSITDAKSCEGQNPELLPKTPISPLKTGVSKPIVKSTLSQTVPSKGELSREICLQSQSKD
  KSTTPGGTGIKPFLERFGERCQEHSKESPARSTPHRTPIITPNTKAIQERLFKQDTSSST
  THLAQQLKQERQKELACLRGRFDKGNIWSAEKGGNSKSKQLETKQETHCQSTPLKKHQGV
  SKTQSLPVTEKVTENQIPAKNSSTEPKGFTECEMTKSSPLKITLFLEEDKSLKVTSDPKV
  EQKIEVIREIEMSVDDDDINSSKVINDLFSDVLEEGELDMEKSQEEMDQALAESSEEQED
  ALNISSMSLLAPLAQTVGVVSPESLVSTPRLELKDTSRSDESPKPGKFQRTRVPRAESGD
  SLGSEDRDLLYSIDAYRSQRFKETERPSIKQVIVRKEDVTSKLDEKNNAFPCQVNIKQKM
  QELNNEINMQQTVIYQASQALNCCVDEEHGKGSLEEAEAERLLLIATGKRTLLIDELNKL
  KNEGPQRKNKASPQSEFMPSKGSVTLSEIRLPLKADFVCSTVQKPDAANYYYLIILKAGA
  ENMVATPLASTSNSLNGDALTFTTTFTLQDVSNDFEINIEVYSLVQKKDPSGLDKKKKTS
  KSKAITPKRLLTSITTKSNIHSSVMASPGGLSAVRTSNFALVGSYTLSLSSVGNTKFVLD
  KVPFLSSLEGHIYLKIKCQVNSSVEERGFLTIFEDVSGFGAWHRRWCVLSGNCISYWTYP
  DDEKRKNPIGRINLANCTSRQIEPANREFCARRNTFELITVRPQREDDRETLVSQCRDTL
  CVTKNWLSADTKEERDLWMQKLNQVLVDIRLWQPDACYKPIGKP
• Function: Required for cytokinesis. Essential for the structural integrity of the cleavage furrow and for completion of cleavage furrow ingression. Plays a role in bleb assembly during metaphase and anaphase of mitosis. May play a significant role in podocyte cell migration.
• Tissue Specificity: Ubiquitously expressed. Present at highest levels in the brain, at high levels in the placenta and testis, at intermediate levels in the intestine, ovary, skeletal muscle and thymus and at lower levels in heart, kidney, liver, lung, pancreas, prostate and spleen. In the kidney, it is widely expressed in tubules, but sparsely expressed in the glomerulus . Expression is significantly increased in renal biopsy specimens from idiopathic FSGS . Overexpressed in many tumor types including breast, colorectal, endometrial, hepatic, kidney, lung, ovarian and pancreatic tumors.
• Reactome Pathway:
  RHOB GTPase cycle (R-HSA-9013026)
  RHOC GTPase cycle (R-HSA-9013106)
  RHOA GTPase cycle (R-HSA-8980692)

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Bladder transitional cell carcinoma	DISNL46A	Definitive	Altered Expression	[1]
Adult respiratory distress syndrome	DISIJV47	Strong	Biomarker	[2]
Branchiootic syndrome	DIS3X164	Strong	Biomarker	[3]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[4]
Bronchiolitis obliterans syndrome	DISCK9IV	Strong	Genetic Variation	[3]
Focal segmental glomerulosclerosis	DISJNHH0	Strong	Biomarker	[2]
Focal segmental glomerulosclerosis 8	DISD93RH	Strong	Autosomal dominant	[5]
Gastric cancer	DISXGOUK	Strong	Biomarker	[6]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[8]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[9]
Nephropathy	DISXWP4P	Strong	Altered Expression	[5]
Nephrotic syndrome, type 2	DISIRFO1	Strong	GermlineCausalMutation	[5]
Pancreatitis	DIS0IJEF	Strong	Biomarker	[10]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[11]
Schizophrenia	DISSRV2N	Strong	Biomarker	[12]
Stomach cancer	DISKIJSX	Strong	Biomarker	[6]
Advanced cancer	DISAT1Z9	moderate	Genetic Variation	[13]
Breast cancer	DIS7DPX1	moderate	Altered Expression	[13]
Breast carcinoma	DIS2UE88	moderate	Altered Expression	[13]
Methicillin-resistant staphylococci infection	DIS6DRDZ	moderate	Biomarker	[14]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[15]
Neoplasm	DISZKGEW	moderate	Altered Expression	[16]
Familial idiopathic steroid-resistant nephrotic syndrome	DISQ53RS	Supportive	Autosomal dominant	[5]
Lung cancer	DISCM4YA	Disputed	Biomarker	[17]
Lung carcinoma	DISTR26C	Disputed	Biomarker	[17]
Non-small-cell lung cancer	DIS5Y6R9	Disputed	Biomarker	[17]
Castration-resistant prostate carcinoma	DISVGAE6	Limited	Altered Expression	[18]
Pancreatic cancer	DISJC981	Limited	Altered Expression	[16]
Pancreatic ductal carcinoma	DIS26F9Q	Limited	Biomarker	[19]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Anillin (ANLN).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Anillin (ANLN).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Anillin (ANLN).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Anillin (ANLN).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Anillin (ANLN).	[24]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Anillin (ANLN).	[25]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Anillin (ANLN).	[26]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Anillin (ANLN).	[27]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Anillin (ANLN).	[28]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Anillin (ANLN).	[29]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Anillin (ANLN).	[29]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Anillin (ANLN).	[30]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Anillin (ANLN).	[31]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Anillin (ANLN).	[32]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Anillin (ANLN).	[33]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Anillin (ANLN).	[34]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Anillin (ANLN).	[35]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Anillin (ANLN).	[36]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Anillin (ANLN).	[37]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Anillin (ANLN).	[38]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Anillin (ANLN).	[39]
GSK2110183	DMZHB37	Phase 2	GSK2110183 decreases the expression of Anillin (ANLN).	[40]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Anillin (ANLN).	[41]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Anillin (ANLN).	[43]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Anillin (ANLN).	[45]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Anillin (ANLN).	[47]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of Anillin (ANLN).	[48]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde decreases the expression of Anillin (ANLN).	[50]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Anillin (ANLN).	[51]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Anillin (ANLN).	[52]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Anillin (ANLN).	[53]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
G1	DMTV42K	Phase 1/2	G1 increases the phosphorylation of Anillin (ANLN).	[42]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Anillin (ANLN).	[44]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Anillin (ANLN).	[46]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Anillin (ANLN).	[49]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Anillin (ANLN).	[46]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Anillin (ANLN).	[54]

References

• [1] Transcriptome sequencing identifies ANLN as a promising prognostic biomarker in bladder urothelial carcinoma.Sci Rep. 2017 Jun 9;7(1):3151. doi: 10.1038/s41598-017-02990-9.
• [2] ANLN truncation causes a familial fatal acute respiratory distress syndrome in Dalmatian dogs.PLoS Genet. 2017 Feb 21;13(2):e1006625. doi: 10.1371/journal.pgen.1006625. eCollection 2017 Feb.
• [3] Identification of ANLN as a new likely pathogenic gene of branchio-otic syndrome in a three-generation Chinese family.Mol Genet Genomic Med. 2019 Feb;7(2):e00525. doi: 10.1002/mgg3.525. Epub 2018 Dec 11.
• [4] ANLN is a prognostic biomarker independent of Ki-67 and essential for cell cycle progression in primary breast cancer.BMC Cancer. 2016 Nov 18;16(1):904. doi: 10.1186/s12885-016-2923-8.
• [5] Mutations in the gene that encodes the F-actin binding protein anillin cause FSGS. J Am Soc Nephrol. 2014 Sep;25(9):1991-2002. doi: 10.1681/ASN.2013090976. Epub 2014 Mar 27.
• [6] In silico analysis of expression pattern of a Wnt/-catenin responsive gene ANLN in gastric cancer.Gene. 2014 Jul 15;545(1):23-9. doi: 10.1016/j.gene.2014.05.013. Epub 2014 May 5.
• [7] Anillin is required for tumor growth and regulated by miR-15a/miR-16-1 in HBV-related hepatocellular carcinoma.Aging (Albany NY). 2018 Aug 9;10(8):1884-1901. doi: 10.18632/aging.101510.
• [8] Identification of significant gene and pathways involved in HBV-related hepatocellular carcinoma by bioinformatics analysis.PeerJ. 2019 Jul 30;7:e7408. doi: 10.7717/peerj.7408. eCollection 2019.
• [9] Identification of a panel of mitotic spindle-related genes as a signature predicting survival in lung adenocarcinoma.J Cell Physiol. 2020 May;235(5):4361-4375. doi: 10.1002/jcp.29312. Epub 2019 Oct 21.
• [10] NBL1 and anillin (ANLN) genes over-expression in pancreatic carcinoma.Folia Histochem Cytobiol. 2009;47(2):249-55. doi: 10.2478/v10042-009-0031-1.
• [11] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [12] Altered cortical CDC42 signaling pathways in schizophrenia: implications for dendritic spine deficits.Biol Psychiatry. 2010 Jul 1;68(1):25-32. doi: 10.1016/j.biopsych.2010.02.016. Epub 2010 Apr 10.
• [13] Common genetic variants contribute to incomplete penetrance: evidence from cancer-free BRCA1 mutation carriers.Eur J Cancer. 2019 Jan;107:68-78. doi: 10.1016/j.ejca.2018.10.022. Epub 2018 Dec 11.
• [14] Good performance of the SpectraCellRA system for typing of methicillin-resistant Staphylococcus aureus isolates.J Clin Microbiol. 2013 May;51(5):1434-8. doi: 10.1128/JCM.02101-12. Epub 2013 Feb 20.
• [15] The potent tumor suppressor miR-497 inhibits cancer phenotypes in nasopharyngeal carcinoma by targeting ANLN and HSPA4L.Oncotarget. 2015 Nov 3;6(34):35893-907. doi: 10.18632/oncotarget.5651.
• [16] ANLN-induced EZH2 upregulation promotes pancreatic cancer progression by mediating miR-218-5p/LASP1 signaling axis.J Exp Clin Cancer Res. 2019 Aug 8;38(1):347. doi: 10.1186/s13046-019-1340-7.
• [17] ANLN plays a critical role in human lung carcinogenesis through the activation of RHOA and by involvement in the phosphoinositide 3-kinase/AKT pathway.Cancer Res. 2005 Dec 15;65(24):11314-25. doi: 10.1158/0008-5472.CAN-05-1507.
• [18] Integrative Genomic Analysis of OCT1 Reveals Coordinated Regulation of Androgen Receptor in Advanced Prostate Cancer.Endocrinology. 2019 Feb 1;160(2):463-472. doi: 10.1210/en.2018-00923.
• [19] Regulation of actin-binding protein ANLN by antitumor miR-217 inhibits cancer cell aggressiveness in pancreatic ductal adenocarcinoma.Oncotarget. 2017 May 29;8(32):53180-53193. doi: 10.18632/oncotarget.18261. eCollection 2017 Aug 8.
• [20] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [21] Inter-laboratory comparison of human renal proximal tubule (HK-2) transcriptome alterations due to Cyclosporine A exposure and medium exhaustion. Toxicol In Vitro. 2009 Apr;23(3):486-99.
• [22] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Global gene expression profiles induced by phytoestrogens in human breast cancer cells. Endocr Relat Cancer. 2008 Mar;15(1):161-73.
• [26] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [27] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [28] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [29] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [30] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [31] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [32] Effects of progesterone treatment on expression of genes involved in uterine quiescence. Reprod Sci. 2011 Aug;18(8):781-97.
• [33] Apoptosis, cell cycle progression and gene expression in TP53-depleted HCT116 colon cancer cells in response to short-term 5-fluorouracil treatment. Int J Oncol. 2007 Dec;31(6):1491-500.
• [34] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [35] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [36] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [37] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [38] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [39] Resveratrol-induced gene expression profiles in human prostate cancer cells. Cancer Epidemiol Biomarkers Prev. 2005 Mar;14(3):596-604. doi: 10.1158/1055-9965.EPI-04-0398.
• [40] Novel ATP-competitive Akt inhibitor afuresertib suppresses the proliferation of malignant pleural mesothelioma cells. Cancer Med. 2017 Nov;6(11):2646-2659. doi: 10.1002/cam4.1179. Epub 2017 Sep 27.
• [41] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [42] The G Protein-Coupled Estrogen Receptor Agonist G-1 Inhibits Nuclear Estrogen Receptor Activity and Stimulates Novel Phosphoproteomic Signatures. Toxicol Sci. 2016 Jun;151(2):434-46. doi: 10.1093/toxsci/kfw057. Epub 2016 Mar 29.
• [43] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [44] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [45] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [46] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [47] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [48] Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
• [49] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [50] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [51] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [52] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [53] Persistence of epigenomic effects after recovery from repeated treatment with two nephrocarcinogens. Front Genet. 2018 Dec 3;9:558.
• [54] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.