Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYEC4IR)

DOT Name Protein FEV (FEV)
Synonyms Fifth Ewing variant protein; PC12 ETS domain-containing transcription factor 1; PC12 ETS factor 1; Pet-1
Gene Name FEV
Related Disease
Invasive breast carcinoma ( )
Allergic rhinitis ( )
Alpha-1 antitrypsin deficiency ( )
Ataxia-telangiectasia ( )
Autism spectrum disorder ( )
Bacterial infection ( )
Breast neoplasm ( )
Carcinoma of esophagus ( )
Chronic bronchitis ( )
Depression ( )
Esophageal cancer ( )
Ewing sarcoma ( )
Ewing sarcoma/peripheral primitive neuroectodermal tumor ( )
Head-neck squamous cell carcinoma ( )
Hepatitis C virus infection ( )
Lung cancer ( )
Lung carcinoma ( )
Malignant soft tissue neoplasm ( )
Meconium ileus ( )
Myocardial ischemia ( )
Neoplasm ( )
Neoplasm of esophagus ( )
Obstructive lung disease ( )
Pneumonia ( )
Pneumonitis ( )
Pneumothorax ( )
Prostate carcinoma ( )
Respiratory disease ( )
Respiratory failure ( )
Rhinitis ( )
Sarcoma ( )
Trigeminal neuralgia ( )
Mood disorder ( )
Rhabdomyosarcoma ( )
Type-1/2 diabetes ( )
Pulmonary emphysema ( )
Diphtheria ( )
Microscopic polyangiitis ( )
Squamous cell carcinoma ( )
UniProt ID
FEV_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2YPR; 3ZP5
Pfam ID
PF00178
Sequence
MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQIQLWQFLLELLADR
ANAGCIAWEGGHGEFKLTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMSKVHGK
RYAYRFDFQGLAQACQPPPAHAHAAAAAAAAAAAAQDGALYKLPAGLAPLPFPGLSKLNL
MAASAGVAPAGFSYWPGPGPAATAAAATAALYPSPSLQPPPGPFGAVAAASHLGGHYH
Function
Functions as a transcriptional regulator. According to PubMed:12761502, it functions as a transcriptional repressor. Functions in the differentiation and the maintenance of the central serotonergic neurons. May play a role in cell growth.
Tissue Specificity In brain, exclusively expressed in the major serotonergic neurons of the dorsal and median raphe nuclei located in the midbrain and pons. Also detected in prostate and small intestine.
KEGG Pathway
Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Invasive breast carcinoma DISANYTW Definitive Biomarker [1]
Allergic rhinitis DIS3U9HN Strong Biomarker [2]
Alpha-1 antitrypsin deficiency DISQKEHW Strong Biomarker [3]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [4]
Autism spectrum disorder DISXK8NV Strong Genetic Variation [5]
Bacterial infection DIS5QJ9S Strong Genetic Variation [6]
Breast neoplasm DISNGJLM Strong Biomarker [7]
Carcinoma of esophagus DISS6G4D Strong Genetic Variation [8]
Chronic bronchitis DISS8O8V Strong Genetic Variation [9]
Depression DIS3XJ69 Strong Biomarker [10]
Esophageal cancer DISGB2VN Strong Genetic Variation [8]
Ewing sarcoma DISQYLV3 Strong Genetic Variation [11]
Ewing sarcoma/peripheral primitive neuroectodermal tumor DISD4VQC Strong Genetic Variation [12]
Head-neck squamous cell carcinoma DISF7P24 Strong Biomarker [13]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [14]
Lung cancer DISCM4YA Strong Genetic Variation [15]
Lung carcinoma DISTR26C Strong Genetic Variation [15]
Malignant soft tissue neoplasm DISTC6NO Strong Biomarker [16]
Meconium ileus DISOWS20 Strong Genetic Variation [17]
Myocardial ischemia DISFTVXF Strong Biomarker [18]
Neoplasm DISZKGEW Strong Biomarker [12]
Neoplasm of esophagus DISOLKAQ Strong Genetic Variation [8]
Obstructive lung disease DIS4IIDZ Strong Genetic Variation [19]
Pneumonia DIS8EF3M Strong Biomarker [20]
Pneumonitis DIS88E0K Strong Biomarker [20]
Pneumothorax DISP86H1 Strong Biomarker [21]
Prostate carcinoma DISMJPLE Strong Genetic Variation [12]
Respiratory disease DISGGAGJ Strong Biomarker [22]
Respiratory failure DISVMYJO Strong Genetic Variation [23]
Rhinitis DISKLMN7 Strong Genetic Variation [24]
Sarcoma DISZDG3U Strong Biomarker [16]
Trigeminal neuralgia DIS31ZY6 Strong Biomarker [25]
Mood disorder DISLVMWO moderate Genetic Variation [26]
Rhabdomyosarcoma DISNR7MS moderate Biomarker [27]
Type-1/2 diabetes DISIUHAP moderate Biomarker [28]
Pulmonary emphysema DIS5M7HZ Disputed Biomarker [29]
Diphtheria DISZWM55 Limited Biomarker [30]
Microscopic polyangiitis DIS74KSO Limited Biomarker [31]
Squamous cell carcinoma DISQVIFL Limited Biomarker [32]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protein FEV (FEV). [33]
------------------------------------------------------------------------------------

References

1 Dual-Time-Point FDG Uptake Correlates with Prognostic Factors of Invasive Breast Cancer: Clinical Usefulness of Early Delayed Scanning.Diagnostics (Basel). 2019 Apr 9;9(2):40. doi: 10.3390/diagnostics9020040.
2 Spirometric parameters and levels of interferon gamma and IL-5 in induced sputum from patients with allergic rhinitis or asthma.Am J Rhinol Allergy. 2011 Sep-Oct;25(5):e196-9. doi: 10.2500/ajra.2011.25.3642.
3 Glutathione S-transferase P1 and lung function in patients with alpha1-antitrypsin deficiency and COPD.Chest. 2005 May;127(5):1537-43. doi: 10.1378/chest.127.5.1537.
4 Lack of association between GTF2H4 genetic variants and AERD development and FEV1 decline by aspirin provocation.Int J Immunogenet. 2012 Dec;39(6):486-91. doi: 10.1111/j.1744-313X.2012.01118.x. Epub 2012 Apr 24.
5 Recessive gene disruptions in autism spectrum disorder.Nat Genet. 2019 Jul;51(7):1092-1098. doi: 10.1038/s41588-019-0433-8. Epub 2019 Jun 17.
6 Viral and atypical bacterial infections in the outpatient pediatric cystic fibrosis clinic.Pediatr Pulmonol. 2006 Dec;41(12):1197-204. doi: 10.1002/ppul.20517.
7 Molecular subtypes of breast cancer: metabolic correlation with F-FDG PET/CT.Eur J Nucl Med Mol Imaging. 2013 Sep;40(9):1304-11. doi: 10.1007/s00259-013-2418-7. Epub 2013 Apr 30.
8 Prognostic values of mid-radiotherapy (18)F-FDG PET/CT in patients with esophageal cancer.Radiat Oncol. 2019 Feb 4;14(1):27. doi: 10.1186/s13014-019-1232-1.
9 Wood smoke exposure and gene promoter methylation are associated with increased risk for COPD in smokers.Am J Respir Crit Care Med. 2010 Nov 1;182(9):1098-104. doi: 10.1164/rccm.201002-0222OC. Epub 2010 Jul 1.
10 Convergent effects of mouse Pet-1 deletion and human PET-1 variation on amygdala fear and threat processing.Exp Neurol. 2013 Dec;250:260-9. doi: 10.1016/j.expneurol.2013.09.025. Epub 2013 Oct 4.
11 Ewing sarcoma with FEV gene rearrangements is a rare subset with predilection for extraskeletal locations and aggressive behavior.Genes Chromosomes Cancer. 2020 May;59(5):286-294. doi: 10.1002/gcc.22828. Epub 2019 Dec 3.
12 Prostatic carcinoma with neuroendocrine differentiation harboring the EWSR1-FEV fusion transcript in a man with the WRN G327X germline mutation: A new variant of prostatic carcinoma or a member of the Ewing sarcoma family of tumors?.Pathol Res Pract. 2020 Feb;216(2):152758. doi: 10.1016/j.prp.2019.152758. Epub 2019 Nov 22.
13 DNA ploidy, S-phase fraction and associations with 2-18F-fluoro-deoxy-2-D-glucose positron emission tomography findings before and during therapy of head and neck squamous cell carcinoma.Acta Otolaryngol. 2004 Aug;124(6):712-9. doi: 10.1080/00016480410016973.
14 Prevalence of hepatitis C virus infection in patients with COPD.Epidemiol Infect. 2010 Feb;138(2):167-73. doi: 10.1017/S0950268809990276. Epub 2009 Jun 29.
15 Incremental value of pulmonary function and sputum DNA image cytometry in lung cancer risk prediction.Cancer Prev Res (Phila). 2011 Apr;4(4):552-61. doi: 10.1158/1940-6207.CAPR-10-0183. Epub 2011 Mar 16.
16 Ewing sarcoma with novel translocation t(2;16) producing an in-frame fusion of FUS and FEV.J Mol Diagn. 2007 Sep;9(4):459-63. doi: 10.2353/jmoldx.2007.070009. Epub 2007 Jul 9.
17 Body composition and lung function in children with cystic fibrosis and meconium ileus.Eur J Pediatr. 2017 Jun;176(6):737-743. doi: 10.1007/s00431-017-2906-z. Epub 2017 Apr 13.
18 Cardioplegia prevents ischemia-induced transcriptional alterations of cytoprotective genes in rat hearts: a DNA microarray study.J Thorac Cardiovasc Surg. 2005 Oct;130(4):1151. doi: 10.1016/j.jtcvs.2005.06.027.
19 Dietary factors and lung function in the general population: wine and resveratrol intake.Eur Respir J. 2012 Feb;39(2):385-91. doi: 10.1183/09031936.00184110. Epub 2011 Aug 18.
20 Circulating RNA transcripts identify therapeutic response in cystic fibrosis lung disease.Am J Respir Crit Care Med. 2008 Nov 1;178(9):929-38. doi: 10.1164/rccm.200803-387OC. Epub 2008 Aug 21.
21 Genetic and morphologic determinants of pneumothorax in lymphangioleiomyomatosis.Am J Physiol Lung Cell Mol Physiol. 2007 Sep;293(3):L800-8. doi: 10.1152/ajplung.00176.2007. Epub 2007 Jul 6.
22 Lower FEV1 in non-COPD, nonasthmatic subjects: association with smoking, annual decline in FEV1, total IgE levels, and TSLP genotypes.Int J Chron Obstruct Pulmon Dis. 2011;6:181-9. doi: 10.2147/COPD.S16383. Epub 2011 Mar 2.
23 Association between genetically determined pancreatic status and lung disease in adult cystic fibrosis patients.Chest. 2002 Jan;121(1):73-80. doi: 10.1378/chest.121.1.73.
24 Association between asthma-related phenotypes and the CC16 A38G polymorphism in an unselected population of young adult Danes.Immunogenetics. 2005 Apr;57(1-2):25-32. doi: 10.1007/s00251-005-0778-2. Epub 2005 Mar 3.
25 Additional value of (18)F-FDG PET/CT response evaluation in axillary nodes during neoadjuvant therapy for triple-negative and HER2-positive breast cancer.Cancer Imaging. 2017 May 25;17(1):15. doi: 10.1186/s40644-017-0117-5.
26 The expression of the transcription factor FEV in adult human brain and its association with affective disorders.J Neural Transm (Vienna). 2010 Jul;117(7):831-6. doi: 10.1007/s00702-010-0405-8. Epub 2010 May 18.
27 Differentiating Ewing's sarcoma from other round blue cell tumors using a RT-PCR translocation panel on formalin-fixed paraffin-embedded tissues.Mod Pathol. 2007 Mar;20(3):397-404. doi: 10.1038/modpathol.3800755.
28 Diabetes mellitus and survival in cystic fibrosis patients after lung transplantation.J Cyst Fibros. 2012 Mar;11(2):131-6. doi: 10.1016/j.jcf.2011.10.005. Epub 2011 Nov 22.
29 1,6-Fucosyltransferase (Fut8) is implicated in vulnerability to elastase-induced emphysema in mice and a possible non-invasive predictive marker for disease progression and exacerbations in chronic obstructive pulmonary disease (COPD).Biochem Biophys Res Commun. 2012 Jul 20;424(1):112-7. doi: 10.1016/j.bbrc.2012.06.081. Epub 2012 Jun 23.
30 Enhanced dendritic morphogenesis of adult hippocampal newborn neurons in central 5-HT-deficient mice.Stem Cell Res. 2017 Mar;19:6-11. doi: 10.1016/j.scr.2016.12.018. Epub 2016 Dec 15.
31 Pulmonary outcome in cystic fibrosis is influenced primarily by mucoid Pseudomonas aeruginosa infection and immune status and only modestly by genotype.Infect Immun. 1999 Sep;67(9):4744-50. doi: 10.1128/IAI.67.9.4744-4750.1999.
32 The prognostic impact of combined pulmonary fibrosis and emphysema in patients with clinical stage IA non-small cell lung cancer.Surg Today. 2018 Feb;48(2):229-235. doi: 10.1007/s00595-017-1577-8. Epub 2017 Aug 18.
33 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.