Details of the Drug

General Information of Drug (ID: DM4AK0Q)

Drug Name
Interferon alfa-n1
Synonyms Well-feron; Interferon alfa-n1 (USAN); Well-feron (TN)
Indication
Disease Entry ICD 11 Status REF
Chronic myelogenous leukaemia 2A20.0 Approved [1]
Therapeutic Class
Antiviral Agents
Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
ADMET Property
Half-life
The concentration or amount of drug in body reduced by one-half in 1.2 hours [2]
Cross-matching ID
DrugBank ID
DB00011
TTD ID
D03QCW

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Interferon alpha/beta receptor 2 (IFNAR2) TTMQB37 INAR2_HUMAN Binder [3]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Same Disease as Interferon alfa-n1
DDI Drug Name DDI Drug ID Severity Mechanism Disease REF
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [4]
Coadministration of a Drug Treating the Disease Different from Interferon alfa-n1 (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [5]
Thioguanine DM7NKEV Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Thioguanine. Acute myeloid leukaemia [2A60] [6]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [7]
Aminophylline DML2NIB Moderate Decreased metabolism of Interferon alfa-n1 caused by Aminophylline mediated inhibition of CYP450 enzyme. Asthma [CA23] [5]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Roflumilast. Asthma [CA23] [8]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [9]
PMID27977313-Compound-29 DMIF7KG Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and PMID27977313-Compound-29. Discovery agent [N.A.] [10]
PMID28870136-Compound-48 DMPIM9L Moderate Decreased metabolism of Interferon alfa-n1 caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme. Discovery agent [N.A.] [5]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Cannabidiol. Epileptic encephalopathy [8A62] [8]
Brentuximab vedotin DMWLC57 Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfa-n1 and Brentuximab vedotin. Hodgkin lymphoma [2B30] [11]
Efavirenz DMC0GSJ Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Efavirenz. Human immunodeficiency virus disease [1C60-1C62] [12]
Zalcitabine DMH7MUV Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfa-n1 and Zalcitabine. Human immunodeficiency virus disease [1C60-1C62] [13]
Mipomersen DMGSRN1 Major Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Mipomersen. Hyper-lipoproteinaemia [5C80] [14]
Teriflunomide DMQ2FKJ Major Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Teriflunomide. Hyper-lipoproteinaemia [5C80] [15]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and BMS-201038. Hyper-lipoproteinaemia [5C80] [16]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfa-n1 and Polyethylene glycol. Irritable bowel syndrome [DD91] [17]
Methotrexate DM2TEOL Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Methotrexate. Leukaemia [2A60-2B33] [8]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Denosumab. Low bone mass disorder [FB83] [18]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [10]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Cladribine. Mature B-cell leukaemia [2A82] [8]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Idelalisib. Mature B-cell leukaemia [2A82] [19]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Alemtuzumab. Mature B-cell leukaemia [2A82] [20]
Clofarabine DMCVJ86 Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Clofarabine. Mature B-cell lymphoma [2A85] [21]
Thalidomide DM70BU5 Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfa-n1 and Thalidomide. Multiple myeloma [2A83] [13]
Bortezomib DMNO38U Moderate Increased risk of peripheral neuropathy by the combination of Interferon alfa-n1 and Bortezomib. Multiple myeloma [2A83] [13]
Interferon beta-1a DM1A6RV Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Interferon beta-1a. Multiple sclerosis [8A40] [22]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Tecfidera. Multiple sclerosis [8A40] [23]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Siponimod. Multiple sclerosis [8A40] [5]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Fingolimod. Multiple sclerosis [8A40] [24]
Interferon beta-1b DMCN61Z Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Interferon beta-1b. Multiple sclerosis [8A40] [22]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Ocrelizumab. Multiple sclerosis [8A40] [25]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Ozanimod. Multiple sclerosis [8A40] [8]
Bupropion DM5PCS7 Major Increased risk of lowers seizure threshold by the combination of Interferon alfa-n1 and Bupropion. Nicotine use disorder [6C4A] [26]
Tramadol DMRQD04 Major Increased risk of lowers seizure threshold by the combination of Interferon alfa-n1 and Tramadol. Pain [MG30-MG3Z] [27]
Ropinirole DMA6S1D Moderate Decreased metabolism of Interferon alfa-n1 caused by Ropinirole mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [28]
Lindane DMB8CNL Moderate Increased risk of lowers seizure threshold by the combination of Interferon alfa-n1 and Lindane. Pediculosis [1G00] [29]
Leflunomide DMR8ONJ Major Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Leflunomide. Rheumatoid arthritis [FA20] [15]
Pimozide DMW83TP Moderate Decreased metabolism of Interferon alfa-n1 caused by Pimozide mediated inhibition of CYP450 enzyme. Schizophrenia [6A20] [30]
Trabectedin DMG3Y89 Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [8]
Naltrexone DMUL45H Moderate Increased risk of hepatotoxicity by the combination of Interferon alfa-n1 and Naltrexone. Substance abuse [6C40] [31]
Azathioprine DMMZSXQ Moderate Additive immunosuppressive effects by the combination of Interferon alfa-n1 and Azathioprine. Transplant rejection [NE84] [5]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Interferon alfa-n1 and Ganciclovir. Virus infection [1A24-1D9Z] [5]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Interferon alfa-n1 and Valganciclovir. Virus infection [1A24-1D9Z] [5]
⏷ Show the Full List of 43 DDI Information of This Drug

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3 Lymphoblastoid interferon alfa-n1 improves the long-term response to a 6-month course of treatment in chronic hepatitis C compared with recombinant interferon alfa-2b: results of an international randomized controlled trial. Clinical Advisory Group for the Hepatitis C Comparative Study. Hepatology. 1998 Apr;27(4):1121-7.
4 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
5 Cerner Multum, Inc. "Australian Product Information.".
6 Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
7 Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
8 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
9 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
10 Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
11 Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
12 Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
13 Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931]
14 Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
15 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
16 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
17 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
18 Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
19 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
20 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
21 Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
22 Product Information. Avonex (interferon beta-1a). Biogen, Cambridge, MA.
23 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
24 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
25 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
26 Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
27 Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
28 Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
29 Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
30 Krahenbuhl S, Sauter B, Kupferschmidt H, Krause M, Wyss PA, Meier PJ "Case report: reversible QT prolongation with torsades de pointes in a patient with pimozide intoxication." Am J Med Sci 309 (1995): 315-6. [PMID: 7771501]
31 Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.