Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0B1T2B)

DOT Name Tripartite motif-containing protein 44 (TRIM44)
Synonyms Protein DIPB
Gene Name TRIM44
Related Disease
Glioblastoma multiforme ( )
Lung cancer ( )
Lung carcinoma ( )
Non-small-cell lung cancer ( )
Adenocarcinoma ( )
Aniridia ( )
Breast cancer ( )
Breast carcinoma ( )
Carcinoma of esophagus ( )
Cervical cancer ( )
Cervical carcinoma ( )
Colorectal carcinoma ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Glioma ( )
Hepatocellular carcinoma ( )
Intrahepatic cholangiocarcinoma ( )
Melanoma ( )
Neoplasm ( )
Neoplasm of esophagus ( )
Nongerminomatous germ cell tumor ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Prostate cancer ( )
Prostate carcinoma ( )
Stomach cancer ( )
Testicular germ cell tumor ( )
Isolated aniridia ( )
Advanced cancer ( )
Aniridia 3 ( )
Metastatic malignant neoplasm ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid gland papillary carcinoma ( )
Thyroid tumor ( )
UniProt ID
TRI44_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00643
Sequence
MASGVGAAFEELPHDGTCDECEPDEAPGAEEVCRECGFCYCRRHAEAHRQKFLSHHLAEY
VHGSQAWTPPADGEGAGKEEAEVKVEQEREIESEAGEESESEEESESEEESETEEESEDE
SDEESEEDSEEEMEDEQESEAEEDNQEEGESEAEGETEAESEFDPEIEMEAERVAKRKCP
DHGLDLSTYCQEDRQLICVLCPVIGAHQGHQLSTLDEAFEELRSKDSGGLKAAMIELVER
LKFKSSDPKVTRDQMKMFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQ
SHMDRLMTQMAQAKEQLDTSNESAEPKAEGDEEGPSGASEEEDT
Function May play a role in the process of differentiation and maturation of neuronal cells. May regulate the activity of TRIM17. Is a negative regulator of PAX6 expression.
Tissue Specificity Highly expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Glioblastoma multiforme DISK8246 Definitive Biomarker [1]
Lung cancer DISCM4YA Definitive Altered Expression [2]
Lung carcinoma DISTR26C Definitive Altered Expression [2]
Non-small-cell lung cancer DIS5Y6R9 Definitive Biomarker [2]
Adenocarcinoma DIS3IHTY Strong Altered Expression [2]
Aniridia DIS1P333 Strong GermlineCausalMutation [3]
Breast cancer DIS7DPX1 Strong Biomarker [4]
Breast carcinoma DIS2UE88 Strong Biomarker [4]
Carcinoma of esophagus DISS6G4D Strong Biomarker [5]
Cervical cancer DISFSHPF Strong Altered Expression [6]
Cervical carcinoma DIST4S00 Strong Altered Expression [6]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [7]
Endometrial cancer DISW0LMR Strong Biomarker [8]
Endometrial carcinoma DISXR5CY Strong Biomarker [8]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [4]
Esophageal cancer DISGB2VN Strong Biomarker [5]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [9]
Gastric cancer DISXGOUK Strong Altered Expression [10]
Glioma DIS5RPEH Strong Biomarker [4]
Hepatocellular carcinoma DIS0J828 Strong Altered Expression [11]
Intrahepatic cholangiocarcinoma DIS6GOC8 Strong Altered Expression [12]
Melanoma DIS1RRCY Strong Biomarker [13]
Neoplasm DISZKGEW Strong Altered Expression [6]
Neoplasm of esophagus DISOLKAQ Strong Biomarker [5]
Nongerminomatous germ cell tumor DISQOQJU Strong Altered Expression [14]
Ovarian cancer DISZJHAP Strong Biomarker [4]
Ovarian neoplasm DISEAFTY Strong Biomarker [4]
Prostate cancer DISF190Y Strong Biomarker [15]
Prostate carcinoma DISMJPLE Strong Biomarker [15]
Stomach cancer DISKIJSX Strong Altered Expression [10]
Testicular germ cell tumor DIS5RN24 Strong Biomarker [14]
Isolated aniridia DISPEZG6 Supportive Autosomal dominant [3]
Advanced cancer DISAT1Z9 Limited Altered Expression [6]
Aniridia 3 DIS3H757 Limited Autosomal dominant [16]
Metastatic malignant neoplasm DIS86UK6 Limited Altered Expression [13]
Thyroid cancer DIS3VLDH Limited Biomarker [17]
Thyroid gland carcinoma DISMNGZ0 Limited Biomarker [17]
Thyroid gland papillary carcinoma DIS48YMM Limited Biomarker [17]
Thyroid tumor DISLVKMD Limited Biomarker [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 39 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Tripartite motif-containing protein 44 (TRIM44). [18]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Tripartite motif-containing protein 44 (TRIM44). [22]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Tripartite motif-containing protein 44 (TRIM44). [19]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Tripartite motif-containing protein 44 (TRIM44). [20]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Tripartite motif-containing protein 44 (TRIM44). [21]
Tocopherol DMBIJZ6 Phase 2 Tocopherol increases the expression of Tripartite motif-containing protein 44 (TRIM44). [23]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Tripartite motif-containing protein 44 (TRIM44). [24]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of Tripartite motif-containing protein 44 (TRIM44). [25]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Tripartite motif-containing protein 44 (TRIM44). [26]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 MiR-101-3p inhibits EMT to attenuate proliferation and metastasis in glioblastoma by targeting TRIM44.J Neurooncol. 2019 Jan;141(1):19-30. doi: 10.1007/s11060-018-2973-7. Epub 2018 Dec 11.
2 TRIM44 promotes proliferation and metastasis in nonsmall cell lung cancer via mTOR signaling pathway.Oncotarget. 2016 May 24;7(21):30479-91. doi: 10.18632/oncotarget.8586.
3 Variants in TRIM44 Cause Aniridia by Impairing PAX6 Expression. Hum Mutat. 2015 Dec;36(12):1164-7. doi: 10.1002/humu.22907. Epub 2015 Oct 9.
4 TRIM44 is indispensable for glioma cell proliferation and cell cycle progression through AKT/p21/p27 signaling pathway.J Neurooncol. 2019 Nov;145(2):211-222. doi: 10.1007/s11060-019-03301-0. Epub 2019 Oct 11.
5 TRIM44 promotes human esophageal cancer progression via the AKT/mTOR pathway.Cancer Sci. 2018 Oct;109(10):3080-3092. doi: 10.1111/cas.13762. Epub 2018 Aug 28.
6 High TRIM44 expression as a valuable biomarker for diagnosis and prognosis in cervical cancer.Biosci Rep. 2019 Mar 6;39(3):BSR20181639. doi: 10.1042/BSR20181639. Print 2019 Mar 29.
7 TRIM44 Promotes Colorectal Cancer Proliferation, Migration, and Invasion Through the Akt/mTOR Signaling Pathway.Onco Targets Ther. 2019 Dec 9;12:10693-10701. doi: 10.2147/OTT.S228637. eCollection 2019.
8 High TRIM44 expression in endometrial carcinoma is associated with a poorer patient outcome.Pathol Res Pract. 2018 May;214(5):727-731. doi: 10.1016/j.prp.2018.03.007. Epub 2018 Mar 6.
9 Overexpression of TRIM44 is related to invasive potential and malignant outcomes in esophageal squamous cell carcinoma.Tumour Biol. 2017 Jun;39(6):1010428317700409. doi: 10.1177/1010428317700409.
10 Overexpression of TRIM44 contributes to malignant outcome in gastric carcinoma.Cancer Sci. 2012 Nov;103(11):2021-6. doi: 10.1111/j.1349-7006.2012.02407.x. Epub 2012 Sep 14.
11 High expression of TRIM44 is associated with enhanced cell proliferation, migration, invasion, and resistance to doxorubicin in hepatocellular carcinoma.Tumour Biol. 2016 Nov;37(11):14615-14628. doi: 10.1007/s13277-016-5316-3. Epub 2016 Sep 12.
12 Elevated TRIM44 promotes intrahepatic cholangiocarcinoma progression by inducing cell EMT via MAPK signaling.Cancer Med. 2018 Mar;7(3):796-808. doi: 10.1002/cam4.1313. Epub 2018 Feb 15.
13 TRIM44 activates the AKT/mTOR signal pathway to induce melanoma progression by stabilizing TLR4.J Exp Clin Cancer Res. 2019 Mar 28;38(1):137. doi: 10.1186/s13046-019-1138-7.
14 A novel prognostic factor TRIM44 promotes cell proliferation and migration, and inhibits apoptosis in testicular germ cell tumor.Cancer Sci. 2017 Jan;108(1):32-41. doi: 10.1111/cas.13105. Epub 2016 Dec 1.
15 Knockdown of TRIM44 Inhibits the Proliferation and Invasion in Prostate Cancer Cells.Oncol Res. 2017 Sep 21;25(8):1253-1259. doi: 10.3727/096504017X14854310794561. Epub 2017 Feb 3.
16 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
17 Knockdown of TRIM44 inhibits the proliferation and invasion in papillary thyroid cancer cells through suppressing the Wnt/-catenin signaling pathway.Biomed Pharmacother. 2017 Dec;96:98-103. doi: 10.1016/j.biopha.2017.09.132. Epub 2017 Sep 29.
18 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
19 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
20 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
21 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
22 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
23 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
24 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
25 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
26 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.