Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0DZGY4)

DOT Name Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3)
Synonyms EC 2.7.11.1; PRKR-like endoplasmic reticulum kinase; Pancreatic eIF2-alpha kinase; HsPEK
Gene Name EIF2AK3
Related Disease
Wolcott-Rallison syndrome ( )
UniProt ID
E2AK3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4G31; 4G34; 4M7I; 4X7H; 4X7J; 4X7K; 4X7L; 4X7N; 4X7O; 4YZS; 5SV7; 7MF0; 8EQ9; 8EQD; 8EQE
EC Number
2.7.11.1
Pfam ID
PF00069
Sequence
MERAISPGLLVRALLLLLLLLGLAARTVAAGRARGLPAPTAEAAFGLGAAAAPTSATRVP
AAGAVAAAEVTVEDAEALPAAAGEQEPRGPEPDDETELRPRGRSLVIISTLDGRIAALDP
ENHGKKQWDLDVGSGSLVSSSLSKPEVFGNKMIIPSLDGALFQWDQDRESMETVPFTVES
LLESSYKFGDDVVLVGGKSLTTYGLSAYSGKVRYICSALGCRQWDSDEMEQEEDILLLQR
TQKTVRAVGPRSGNEKWNFSVGHFELRYIPDMETRAGFIESTFKPNENTEESKIISDVEE
QEAAIMDIVIKVSVADWKVMAFSKKGGHLEWEYQFCTPIASAWLLKDGKVIPISLFDDTS
YTSNDDVLEDEEDIVEAARGATENSVYLGMYRGQLYLQSSVRISEKFPSSPKALESVTNE
NAIIPLPTIKWKPLIHSPSRTPVLVGSDEFDKCLSNDKFSHEEYSNGALSILQYPYDNGY
YLPYYKRERNKRSTQITVRFLDNPHYNKNIRKKDPVLLLHWWKEIVATILFCIIATTFIV
RRLFHPHPHRQRKESETQCQTENKYDSVSGEANDSSWNDIKNSGYISRYLTDFEPIQCLG
RGGFGVVFEAKNKVDDCNYAIKRIRLPNRELAREKVMREVKALAKLEHPGIVRYFNAWLE
APPEKWQEKMDEIWLKDESTDWPLSSPSPMDAPSVKIRRMDPFATKEHIEIIAPSPQRSR
SFSVGISCDQTSSSESQFSPLEFSGMDHEDISESVDAAYNLQDSCLTDCDVEDGTMDGND
EGHSFELCPSEASPYVRSRERTSSSIVFEDSGCDNASSKEEPKTNRLHIGNHCANKLTAF
KPTSSKSSSEATLSISPPRPTTLSLDLTKNTTEKLQPSSPKVYLYIQMQLCRKENLKDWM
NGRCTIEERERSVCLHIFLQIAEAVEFLHSKGLMHRDLKPSNIFFTMDDVVKVGDFGLVT
AMDQDEEEQTVLTPMPAYARHTGQVGTKLYMSPEQIHGNSYSHKVDIFSLGLILFELLYP
FSTQMERVRTLTDVRNLKFPPLFTQKYPCEYVMVQDMLSPSPMERPEAINIIENAVFEDL
DFPGKTVLRQRSRSLSSSGTKHSRQSNNSHSPLPSN
Function
Metabolic-stress sensing protein kinase that phosphorylates the alpha subunit of eukaryotic translation initiation factor 2 (EIF2S1/eIF-2-alpha) in response to various stress conditions. Key activator of the integrated stress response (ISR) required for adaptation to various stress, such as unfolded protein response (UPR) and low amino acid availability. EIF2S1/eIF-2-alpha phosphorylation in response to stress converts EIF2S1/eIF-2-alpha in a global protein synthesis inhibitor, leading to a global attenuation of cap-dependent translation, while concomitantly initiating the preferential translation of ISR-specific mRNAs, such as the transcriptional activators ATF4 and QRICH1, and hence allowing ATF4- and QRICH1-mediated reprogramming. Serves as a critical effector of unfolded protein response (UPR)-induced G1 growth arrest due to the loss of cyclin-D1 (CCND1). Involved in control of mitochondrial morphology and function.
Tissue Specificity Ubiquitous. A high level expression is seen in secretory tissues.
KEGG Pathway
Mitophagy - animal (hsa04137 )
Autophagy - animal (hsa04140 )
Protein processing in endoplasmic reticulum (hsa04141 )
Apoptosis (hsa04210 )
Non-alcoholic fatty liver disease (hsa04932 )
Alzheimer disease (hsa05010 )
Parkinson disease (hsa05012 )
Amyotrophic lateral sclerosis (hsa05014 )
Prion disease (hsa05020 )
Pathways of neurodegeneration - multiple diseases (hsa05022 )
Hepatitis C (hsa05160 )
Measles (hsa05162 )
Herpes simplex virus 1 infection (hsa05168 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
ALK mutants bind TKIs (R-HSA-9700645 )
Signaling by ALK fusions and activated point mutants (R-HSA-9725370 )
KEAP1-NFE2L2 pathway (R-HSA-9755511 )
PERK regulates gene expression (R-HSA-381042 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Wolcott-Rallison syndrome DISKVKXN Definitive Autosomal recessive [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 3 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Paclitaxel DMLB81S Approved Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3) affects the response to substance of Paclitaxel. [58]
Fenretinide DMRD5SP Phase 3 Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3) decreases the response to substance of Fenretinide. [59]
Atorvastatin DMF28YC Phase 3 Trial Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3) increases the response to substance of Atorvastatin. [60]
------------------------------------------------------------------------------------
40 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [2]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [3]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [4]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [5]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [8]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [9]
Carbamazepine DMZOLBI Approved Carbamazepine increases the activity of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [11]
Marinol DM70IK5 Approved Marinol decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [12]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [13]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [14]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [13]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [17]
Ethanol DMDRQZU Approved Ethanol increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [18]
Diclofenac DMPIHLS Approved Diclofenac increases the activity of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [11]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [13]
Rifampicin DM5DSFZ Approved Rifampicin increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [19]
Sulindac DM2QHZU Approved Sulindac increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [13]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [22]
Sertraline DM0FB1J Approved Sertraline increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [23]
Glucosamine DM4ZLFD Approved Glucosamine increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [24]
Cantharidin DMBP5N3 Approved Cantharidin increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [25]
Efavirenz DMC0GSJ Approved Efavirenz increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [26]
Indinavir DM0T3YH Approved Indinavir increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [13]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [29]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [30]
Rigosertib DMOSTXF Phase 3 Rigosertib increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [33]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [35]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [36]
ME-344 DM6JN19 Phase 1/2 ME-344 increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [39]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [40]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [41]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [8]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [45]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [46]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [47]
Coumestrol DM40TBU Investigative Coumestrol decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [5]
Sulforaphane DMQY3L0 Investigative Sulforaphane increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [48]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [50]
Paraquat DMR8O3X Investigative Paraquat increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [51]
NMS-873 DMYKZ6U Investigative NMS-873 increases the expression of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [57]
------------------------------------------------------------------------------------
⏷ Show the Full List of 40 Drug(s)
25 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [6]
Quercetin DM3NC4M Approved Quercetin increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [7]
Vorinostat DMWMPD4 Approved Vorinostat increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [10]
Cannabidiol DM0659E Approved Cannabidiol increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [15]
Bortezomib DMNO38U Approved Bortezomib increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [16]
Methamphetamine DMPM4SK Approved Methamphetamine increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [20]
Sorafenib DMS8IFC Approved Sorafenib increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [21]
Niflumic acid DMJ3I1Q Approved Niflumic acid increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [27]
Pyrazinamide DM4IF32 Approved Pyrazinamide increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [28]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [31]
Camptothecin DM6CHNJ Phase 3 Camptothecin increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [32]
Psoralen DMIZJ8M Phase 3 Psoralen increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [34]
URSOLIC ACID DM4SOAW Phase 2 URSOLIC ACID increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [37]
Rocilinostat DMSTH01 Phase 2 Rocilinostat increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [38]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [42]
MG-132 DMKA2YS Preclinical MG-132 increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [43]
Ciglitazone DMAPO0T Preclinical Ciglitazone increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [27]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [44]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [42]
Deguelin DMXT7WG Investigative Deguelin increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [49]
Hexadecanoic acid DMWUXDZ Investigative Hexadecanoic acid increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [52]
D-glucose DMMG2TO Investigative D-glucose increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [53]
(E)-4-(3,5-dimethoxystyryl)phenol DMYXI2V Investigative (E)-4-(3,5-dimethoxystyryl)phenol increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [54]
P-Coumaric Acid DMGJSVD Investigative P-Coumaric Acid increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [55]
1,4-Dithiothreitol DMIFOXE Investigative 1,4-Dithiothreitol increases the phosphorylation of Eukaryotic translation initiation factor 2-alpha kinase 3 (EIF2AK3). [56]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Drug(s)

References

1 Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
2 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
5 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
6 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
7 Effect of quercetin on apoptosis of PANC-1 cells. J Korean Surg Soc. 2013 Dec;85(6):249-60. doi: 10.4174/jkss.2013.85.6.249. Epub 2013 Nov 26.
8 Arsenic trioxide initiates ER stress responses, perturbs calcium signalling and promotes apoptosis in human lens epithelial cells. Exp Eye Res. 2007 Dec;85(6):825-35. doi: 10.1016/j.exer.2007.08.018. Epub 2007 Aug 29.
9 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
10 Autophagy potentiates the anti-cancer effects of the histone deacetylase inhibitors in hepatocellular carcinoma. Autophagy. 2010 Nov;6(8):1057-65. doi: 10.4161/auto.6.8.13365.
11 Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
12 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
13 Drug-induced hepatic steatosis in absence of severe mitochondrial dysfunction in HepaRG cells: proof of multiple mechanism-based toxicity. Cell Biol Toxicol. 2021 Apr;37(2):151-175. doi: 10.1007/s10565-020-09537-1. Epub 2020 Jun 14.
14 Niclosamide induced cell apoptosis via upregulation of ATF3 and activation of PERK in Hepatocellular carcinoma cells. BMC Gastroenterol. 2016 Feb 25;16:25. doi: 10.1186/s12876-016-0442-3.
15 Cannabidiol promotes apoptosis via regulation of XIAP/Smac in gastric cancer. Cell Death Dis. 2019 Nov 7;10(11):846. doi: 10.1038/s41419-019-2001-7.
16 Proteasome inhibitor PS-341 induces apoptosis through induction of endoplasmic reticulum stress-reactive oxygen species in head and neck squamous cell carcinoma cells. Mol Cell Biol. 2004 Nov;24(22):9695-704. doi: 10.1128/MCB.24.22.9695-9704.2004.
17 Hydroquinone triggers pyroptosis and endoplasmic reticulum stress via AhR-regulated oxidative stress in human lymphocytes. Toxicol Lett. 2023 Mar 1;376:39-50. doi: 10.1016/j.toxlet.2023.01.005. Epub 2023 Jan 13.
18 The resveratrol attenuates ethanol-induced hepatocyte apoptosis via inhibiting ER-related caspase-12 activation and PDE activity in vitro. Alcohol Clin Exp Res. 2014 Mar;38(3):683-93. doi: 10.1111/acer.12311. Epub 2013 Nov 13.
19 Rifampicin-induced injury in L02 cells is alleviated by 4-PBA via inhibition of the PERK-ATF4-CHOP pathway. Toxicol In Vitro. 2016 Oct;36:186-196. doi: 10.1016/j.tiv.2016.07.017. Epub 2016 Jul 26.
20 Methamphetamine-mediated endoplasmic reticulum (ER) stress induces type-1 programmed cell death in astrocytes via ATF6, IRE1 and PERK pathways. Oncotarget. 2016 Jul 19;7(29):46100-46119. doi: 10.18632/oncotarget.10025.
21 The kinase inhibitor sorafenib induces cell death through a process involving induction of endoplasmic reticulum stress. Mol Cell Biol. 2007 Aug;27(15):5499-513. doi: 10.1128/MCB.01080-06. Epub 2007 Jun 4.
22 Sirtuin-1 ameliorates cadmium-induced endoplasmic reticulum stress and pyroptosis through XBP-1s deacetylation in human renal tubular epithelial cells. Arch Toxicol. 2019 Apr;93(4):965-986. doi: 10.1007/s00204-019-02415-8. Epub 2019 Feb 22.
23 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
24 NGBR is required to ameliorate type 2 diabetes in mice by enhancing insulin sensitivity. J Biol Chem. 2021 Jan-Jun;296:100624. doi: 10.1016/j.jbc.2021.100624. Epub 2021 Apr 2.
25 Endoplasmic reticulum stress contributes to autophagy and apoptosis in cantharidin-induced nephrotoxicity. Food Chem Toxicol. 2022 May;163:112986. doi: 10.1016/j.fct.2022.112986. Epub 2022 Apr 6.
26 Lon protease: a novel mitochondrial matrix protein in the interconnection between drug-induced mitochondrial dysfunction and endoplasmic reticulum stress. Br J Pharmacol. 2017 Dec;174(23):4409-4429. doi: 10.1111/bph.14045. Epub 2017 Nov 7.
27 Combined treatment with the Cox-2 inhibitor niflumic acid and PPARgama ligand ciglitazone induces ER stress/caspase-8-mediated apoptosis in human lung cancer cells. Cancer Lett. 2011 Jan 28;300(2):134-44.
28 Pyrazinamide-induced hepatotoxicity is alleviated by 4-PBA via inhibition of the PERK-eIF2-ATF4-CHOP pathway. Toxicology. 2017 Mar 1;378:65-75. doi: 10.1016/j.tox.2017.01.002. Epub 2017 Jan 4.
29 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
30 LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
31 Resveratrol induced ER expansion and ER caspase-mediated apoptosis in human nasopharyngeal carcinoma cells. Apoptosis. 2014 Mar;19(3):527-41. doi: 10.1007/s10495-013-0945-0.
32 Camptothecin enhances c-Myc-mediated endoplasmic reticulum stress and leads to autophagy by activating Ca(2+)-mediated AMPK. Food Chem Toxicol. 2018 Nov;121:648-656. doi: 10.1016/j.fct.2018.09.057. Epub 2018 Sep 25.
33 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
34 Psoralen induces hepatic toxicity through PERK and ATF6 related ER stress pathways in HepG2 cells. Toxicol Mech Methods. 2020 Jan;30(1):39-47. doi: 10.1080/15376516.2019.1650150. Epub 2019 Aug 20.
35 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
36 Thymoquinone induces apoptosis in bladder cancer cell via endoplasmic reticulum stress-dependent mitochondrial pathway. Chem Biol Interact. 2018 Aug 25;292:65-75. doi: 10.1016/j.cbi.2018.06.013. Epub 2018 Jul 2.
37 Ursolic acid induces autophagy in U87MG cells via ROS-dependent endoplasmic reticulum stress. Chem Biol Interact. 2014 Jul 25;218:28-41. doi: 10.1016/j.cbi.2014.04.017. Epub 2014 May 5.
38 Preclinical activity, pharmacodynamic, and pharmacokinetic properties of a selective HDAC6 inhibitor, ACY-1215, in combination with bortezomib in multiple myeloma. Blood. 2012 Mar 15;119(11):2579-89. doi: 10.1182/blood-2011-10-387365. Epub 2012 Jan 19.
39 Isoflavone ME-344 Disrupts Redox Homeostasis and Mitochondrial Function by Targeting Heme Oxygenase 1. Cancer Res. 2019 Aug 15;79(16):4072-4085. doi: 10.1158/0008-5472.CAN-18-3503. Epub 2019 Jun 21.
40 JQ1 suppresses tumor growth through downregulating LDHA in ovarian cancer. Oncotarget. 2015 Mar 30;6(9):6915-30. doi: 10.18632/oncotarget.3126.
41 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
42 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
43 The unfolded protein response controls ER stress-induced apoptosis of lung epithelial cells through angiotensin generation. Am J Physiol Lung Cell Mol Physiol. 2016 Nov 1;311(5):L846-L854. doi: 10.1152/ajplung.00449.2015. Epub 2016 Sep 16.
44 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
45 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
46 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
47 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
48 Sulforaphane synergistically enhances the cytotoxicity of arsenic trioxide in multiple myeloma cells via stress-mediated pathways. Oncol Rep. 2012 Nov;28(5):1851-8. doi: 10.3892/or.2012.1977. Epub 2012 Aug 22.
49 Deguelin inhibits the migration and invasion of U-2 OS human osteosarcoma cells via the inhibition of matrix metalloproteinase-2/-9 in vitro. Molecules. 2014 Oct 15;19(10):16588-608.
50 Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
51 CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
52 Soluble epoxide hydrolase deficiency or inhibition attenuates diet-induced endoplasmic reticulum stress in liver and adipose tissue. J Biol Chem. 2013 May 17;288(20):14189-99.
53 HHQ-4, a quinoline derivate, preferentially inhibits proliferation of glucose-deprived breast cancer cells as a GRP78 down-regulator. Toxicol Appl Pharmacol. 2019 Jun 15;373:10-25. doi: 10.1016/j.taap.2019.04.017. Epub 2019 Apr 22.
54 Involvement of the Nrf2 pathway in the regulation of pterostilbene-induced apoptosis in HeLa cells via ER stress. J Pharmacol Sci. 2014;126(3):216-29.
55 Antiproliferative effect of p-Coumaric acid targets UPR activation by downregulating Grp78 in colon cancer. Chem Biol Interact. 2018 Aug 1;291:16-28. doi: 10.1016/j.cbi.2018.06.001. Epub 2018 Jun 5.
56 Hydroxychloroquine-inhibited dengue virus is associated with host defense machinery. J Interferon Cytokine Res. 2015 Mar;35(3):143-56. doi: 10.1089/jir.2014.0038. Epub 2014 Oct 16.
57 Interleukin-6 induced overexpression of valosin-containing protein (VCP)/p97 is associated with androgen-independent prostate cancer (AIPC) progression. J Cell Physiol. 2018 Oct;233(10):7148-7164. doi: 10.1002/jcp.26639. Epub 2018 Apr 25.
58 Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
59 Regulation of endoplasmic reticulum stress-induced cell death by ATF4 in neuroectodermal tumor cells. J Biol Chem. 2010 Feb 26;285(9):6091-100. doi: 10.1074/jbc.M109.014092. Epub 2009 Dec 18.
60 Inhibition of autophagy enhances anticancer effects of atorvastatin in digestive malignancies. Cancer Res. 2010 Oct 1;70(19):7699-709. doi: 10.1158/0008-5472.CAN-10-1626. Epub 2010 Sep 28.