Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2YYI1A)

DOT Name	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1)
Synonyms	Bcl-2-like protein 3; Bcl2-L-3; Bcl-2-related protein EAT/mcl1; mcl1/EAT
Gene Name	MCL1
UniProt ID	MCL1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	2KBW ; 2MHS ; 2NL9 ; 2NLA ; 2PQK ; 3D7V ; 3IO9 ; 3KJ0 ; 3KJ1 ; 3KJ2 ; 3KZ0 ; 3MK8 ; 3PK1 ; 3TWU ; 3WIX ; 3WIY ; 4BPI ; 4BPJ ; 4HW2 ; 4HW3 ; 4HW4 ; 4OQ5 ; 4OQ6 ; 4WGI ; 4WMR ; 4WMS ; 4WMT ; 4WMU ; 4WMV ; 4WMW ; 4WMX ; 4ZBF ; 4ZBI ; 5C3F ; 5C6H ; 5FC4 ; 5FDO ; 5FDR ; 5IEZ ; 5IF4 ; 5JSB ; 5KU9 ; 5LOF ; 5MES ; 5MEV ; 5UUM ; 5VKC ; 5VX2 ; 5W89 ; 5W8F ; 6B4L ; 6B4U ; 6BW2 ; 6BW8 ; 6FS0 ; 6FS1 ; 6FS2 ; 6MBD ; 6MBE ; 6NE5 ; 6O4U ; 6O6F ; 6O6G ; 6OQB ; 6OQC ; 6OQD ; 6OQN ; 6OVC ; 6P3P ; 6QB3 ; 6QB4 ; 6QB6 ; 6QFC ; 6QFI ; 6QFM ; 6QFQ ; 6QGD ; 6QXJ ; 6QYK ; 6QYL ; 6QYN ; 6QYO ; 6QYP ; 6QZ5 ; 6QZ6 ; 6QZ7 ; 6QZ8 ; 6QZB ; 6STJ ; 6U63 ; 6U64 ; 6U65 ; 6U67 ; 6U6F ; 6UA3 ; 6UAB ; 6UD2 ; 6UDI ; 6UDT ; 6UDU ; 6UDV ; 6UDX ; 6UDY ; 6VBX ; 6YBG ; 6YBJ ; 6YBK ; 6YBL ; 6ZIE ; 7NB4 ; 7NB7 ; 7XGE ; 8AV9 ; 8EKX ; 8EL0 ; 8EL1 ; 8G3S ; 8G3T ; 8G3U ; 8G3W ; 8G3X ; 8G3Y ; 8H7B ; 8IQM ; 8SVY
Pfam ID	PF00452
Sequence	MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
Function	Involved in the regulation of apoptosis versus cell survival, and in the maintenance of viability but not of proliferation. Mediates its effects by interactions with a number of other regulators of apoptosis. Isoform 1 inhibits apoptosis. Isoform 2 promotes apoptosis.
KEGG Pathway	PI3K-Akt sig.ling pathway (hsa04151 ) Apoptosis (hsa04210 ) JAK-STAT sig.ling pathway (hsa04630 ) MicroR.s in cancer (hsa05206 )
Reactome Pathway	Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) decreases the response to substance of Fluorouracil.	[94]
Irinotecan	DMP6SC2	Approved	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) decreases the response to substance of Irinotecan.	[95]
Sorafenib	DMS8IFC	Approved	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) decreases the response to substance of Sorafenib.	[96]
Dacarbazine	DMNPZL4	Approved	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) decreases the response to substance of Dacarbazine.	[97]
ABT-737	DML0DBV	Terminated	Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1) decreases the response to substance of ABT-737.	[98]
------------------------------------------------------------------------------------

92 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[8]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[10]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[11]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[12]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[13]
Methotrexate	DM2TEOL	Approved	Methotrexate increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[14]
Marinol	DM70IK5	Approved	Marinol increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[15]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[16]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[17]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[18]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[19]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[21]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[22]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[23]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[24]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[25]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[27]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[28]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[29]
Daunorubicin	DMQUSBT	Approved	Daunorubicin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[30]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[31]
Ursodeoxycholic acid	DMCUT21	Approved	Ursodeoxycholic acid increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[32]
Beta-carotene	DM0RXBT	Approved	Beta-carotene affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[3]
Imatinib	DM7RJXL	Approved	Imatinib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[33]
Sertraline	DM0FB1J	Approved	Sertraline decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[34]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[35]
Docetaxel	DMDI269	Approved	Docetaxel increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[36]
Vitamin A	DMJ2AH4	Approved	Vitamin A affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[3]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[37]
Penicillamine	DM40EF6	Approved	Penicillamine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[38]
Ciprofloxacin XR	DM2NLS9	Approved	Ciprofloxacin XR increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[39]
Romidepsin	DMT5GNL	Approved	Romidepsin increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[40]
Amodiaquine	DME4RA8	Approved	Amodiaquine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[41]
Nelfinavir mesylate	DMFX6G8	Approved	Nelfinavir mesylate increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[42]
Ethacrynic acid	DM60QMR	Approved	Ethacrynic acid decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[43]
Omacetaxine mepesuccinate	DMPU2WX	Approved	Omacetaxine mepesuccinate decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[44]
Fludarabine	DMVRLT7	Approved	Fludarabine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[45]
Plicamycin	DM7C8YV	Approved	Plicamycin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[30]
Promethazine	DM6I5GR	Approved	Promethazine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[46]
Ceritinib	DMB920Z	Approved	Ceritinib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[47]
Venetoclax	DM8I94Y	Approved	Venetoclax decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[48]
Angiotensin Ii	DMLWQ27	Approved	Angiotensin Ii decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[49]
Cepharanthine	DM9Y5JB	Approved	Cepharanthine increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[50]
Clofarabine	DMCVJ86	Approved	Clofarabine decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[51]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[52]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[53]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[54]
Rigosertib	DMOSTXF	Phase 3	Rigosertib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[55]
Atorvastatin	DMF28YC	Phase 3 Trial	Atorvastatin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[56]
Buparlisib	DM1WEHC	Phase 3	Buparlisib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[57]
Phenol	DM1QSM3	Phase 2/3	Phenol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[58]
Contigoside B	DMX9V8K	Phase 2/3	Contigoside B affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[59]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[60]
PEITC	DMOMN31	Phase 2	PEITC decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[61]
APR-246	DMNFADH	Phase 2	APR-246 increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[62]
Tanespimycin	DMNLQHK	Phase 2	Tanespimycin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[63]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[64]
GDC0941	DM1YAK6	Phase 2	GDC0941 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[65]
Flavopiridol	DMKSUOI	Phase 2	Flavopiridol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[66]
BEZ235	DMKBRDL	Phase 2	BEZ235 affects the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[67]
GDC-0980/RG7422	DMF3MV1	Phase 2	GDC-0980/RG7422 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[65]
Ym155	DM5Q1W4	Phase 2	Ym155 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[68]
UCN-01	DMUNJZB	Phase 2	UCN-01 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[69]
PF-04991532	DM94NBE	Phase 2	PF-04991532 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[70]
LTB4	DME26RS	Phase 2	LTB4 increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[71]
Gossypol	DMJWE3I	Phase 2	Gossypol decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[72]
AXL-1717	DMTQ1Y3	Phase 2	AXL-1717 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[73]
INCB057643	DMG65CV	Phase 1/2	INCB057643 increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[74]
Atiprimod	DM84YEC	Phase 1/2	Atiprimod decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[75]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[77]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[78]
Mivebresib	DMCPF90	Phase 1	Mivebresib decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[79]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[80]
AMEP	DMFELMQ	Phase 1	AMEP increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[81]
Tetrandrine	DMAOJBX	Phase 1	Tetrandrine increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[50]
PU-H71	DMIYHAW	Phase 1	PU-H71 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[48]
PMID26394986-Compound-22	DM43Z1G	Patented	PMID26394986-Compound-22 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[84]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[85]
PMID25656651-Compound-5	DMAI95U	Patented	PMID25656651-Compound-5 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[86]
PMID28870136-Compound-49	DMTUC9E	Patented	PMID28870136-Compound-49 increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[87]
Salicylic acid derivative 2	DMD8C9S	Patented	Salicylic acid derivative 2 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[88]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[89]
SK-7041	DM7DNOG	Preclinical	SK-7041 decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[91]
EMODIN	DMAEDQG	Terminated	EMODIN decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[92]
Wortmannin	DM8EVK5	Terminated	Wortmannin decreases the expression of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[93]
------------------------------------------------------------------------------------


⏷ Show the Full List of 92 Drug(s)

3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Cisplatin	DMRHGI9	Approved	Cisplatin increases the degradation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[7]
Bortezomib	DMNO38U	Approved	Bortezomib increases the cleavage of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[20]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the degradation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[90]
------------------------------------------------------------------------------------

5 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Nicotine	DMWX5CO	Approved	Nicotine increases the phosphorylation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[76]
AMG 176	DM0Q7NO	Phase 1	AMG 176 decreases the ubiquitination of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[82]
AZD5991	DM7QGHO	Phase 1	AZD5991 increases the phosphorylation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[82]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Induced myeloid leukemia cell differentiation protein Mcl-1 (MCL1).	[83]
------------------------------------------------------------------------------------

References

1	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
3	Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
4	Acetaminophen-induced proliferation of estrogen-responsive breast cancer cells is associated with increases in c-myc RNA expression and NF-kappaB activity. Toxicol Sci. 2002 Apr;66(2):233-43. doi: 10.1093/toxsci/66.2.233.
5	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7	Increased galectin-3 facilitates leukemia cell survival from apoptotic stimuli. Biochem Biophys Res Commun. 2011 Aug 26;412(2):334-40. doi: 10.1016/j.bbrc.2011.07.099. Epub 2011 Jul 29.
8	Estrogen regulation of apoptosis in osteoblasts. Physiol Behav. 2010 Feb 9;99(2):181-5. doi: 10.1016/j.physbeh.2009.04.025. Epub 2009 May 5.
9	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
10	Application of cDNA microarray to the study of arsenic-induced liver diseases in the population of Guizhou, China. Toxicol Sci. 2001 Jan;59(1):185-92.
11	Multifaceted preventive effects of single agent quercetin on a human prostate adenocarcinoma cell line (PC-3): implications for nutritional transcriptomics and multi-target therapy. Med Oncol. 2011 Dec;28(4):1395-404. doi: 10.1007/s12032-010-9603-3. Epub 2010 Jul 2.
12	[Effect of arsenic trioxide on apoptosis in lymphoblastoid Raji cell line with relation to expression of mcl-1 gene]. Zhongguo Shi Yan Xue Ye Xue Za Zhi. 2009 Jun;17(3):597-601.
13	Apoptosis induction by 1alpha,25-dihydroxyvitamin D3 in prostate cancer. Mol Cancer Ther. 2002 Jul;1(9):667-77.
14	Peripheral blood expression of nuclear factor-kappab-regulated genes is associated with rheumatoid arthritis disease activity and responds differentially to anti-tumor necrosis factor-alpha versus methotrexate. J Rheumatol. 2007 Sep;34(9):1817-22. Epub 2007 Aug 1.
15	Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
16	Glucocorticoids inhibit cell death in ovarian cancer and up-regulate caspase inhibitor cIAP2. Clin Cancer Res. 2005 Sep 1;11(17):6325-32. doi: 10.1158/1078-0432.CCR-05-0182.
17	Effects of folate deficiency on gene expression in the apoptosis and cancer pathways in colon cancer cells. Carcinogenesis. 2006 May;27(5):916-24. doi: 10.1093/carcin/bgi312. Epub 2005 Dec 16.
18	Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
19	Antineoplastic mechanisms of niclosamide in acute myelogenous leukemia stem cells: inactivation of the NF-kappaB pathway and generation of reactive oxygen species. Cancer Res. 2010 Mar 15;70(6):2516-27. doi: 10.1158/0008-5472.CAN-09-3950. Epub 2010 Mar 9.
20	Inhibition of p38alpha MAPK enhances proteasome inhibitor-induced apoptosis of myeloma cells by modulating Hsp27, Bcl-X(L), Mcl-1 and p53 levels in vitro and inhibits tumor growth in vivo. Leukemia. 2006 Jun;20(6):1017-27. doi: 10.1038/sj.leu.2404200.
21	BCL2 inhibitor ABT-199 and BCL2L1 inhibitor WEHI-539 coordinately promote NOXA-mediated degradation of MCL1 in human leukemia cells. Chem Biol Interact. 2022 Jul 1;361:109978. doi: 10.1016/j.cbi.2022.109978. Epub 2022 May 11.
22	The mechanisms of Ara-C-induced apoptosis of resting B-chronic lymphocytic leukemia cells. Haematologica. 2006 Jul;91(7):912-9.
23	Aspirin induces apoptosis in human leukemia cells independently of NF-kappaB and MAPKs through alteration of the Mcl-1/Noxa balance. Apoptosis. 2010 Feb;15(2):219-29. doi: 10.1007/s10495-009-0424-9.
24	Phosphoinositide 3-kinase/Akt pathway plays an important role in chemoresistance of gastric cancer cells against etoposide and doxorubicin induced cell death. Int J Cancer. 2008 Jan 15;122(2):433-43. doi: 10.1002/ijc.23049.
25	Resveratrol modifies the expression of apoptotic regulatory proteins and sensitizes non-Hodgkin's lymphoma and multiple myeloma cell lines to paclitaxel-induced apoptosis. Mol Cancer Ther. 2004 Jan;3(1):71-84.
26	Nicotine enhances the antiapoptotic function of Mcl-1 through phosphorylation. Mol Cancer Res. 2009 Dec;7(12):1954-61. doi: 10.1158/1541-7786.MCR-09-0304. Epub 2009 Nov 10.
27	The kinase inhibitor dasatinib induces apoptosis in chronic lymphocytic leukemia cells in vitro with preference for a subgroup of patients with unmutated IgVH genes. Blood. 2008 Aug 15;112(4):1443-52. doi: 10.1182/blood-2007-11-123984. Epub 2008 Jun 12.
28	Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
29	Triggering of transient receptor potential vanilloid type 1 (TRPV1) by capsaicin induces Fas/CD95-mediated apoptosis of urothelial cancer cells in an ATM-dependent manner. Carcinogenesis. 2009 Aug;30(8):1320-9. doi: 10.1093/carcin/bgp138. Epub 2009 Jun 5.
30	CREB/Sp1-mediated MCL1 expression and NFB-mediated ABCB1 expression modulate the cytotoxicity of daunorubicin in chronic myeloid leukemia cells. Toxicol Appl Pharmacol. 2022 Jan 15;435:115847. doi: 10.1016/j.taap.2021.115847. Epub 2021 Dec 25.
31	Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
32	The synthetic bile acid-phospholipid conjugate ursodeoxycholyl lysophosphatidylethanolamide suppresses TNF-induced liver injury. J Hepatol. 2011 Apr;54(4):674-84. doi: 10.1016/j.jhep.2010.07.028. Epub 2010 Sep 27.
33	Efficacy of the polo-like kinase inhibitor rigosertib, alone or in combination with Abelson tyrosine kinase inhibitors, against break point cluster region-c-Abelson-positive leukemia cells. Oncotarget. 2015 Aug 21;6(24):20231-40. doi: 10.18632/oncotarget.4047.
34	Sertraline, an antidepressant, induces apoptosis in hepatic cells through the mitogen-activated protein kinase pathway. Toxicol Sci. 2014 Feb;137(2):404-15. doi: 10.1093/toxsci/kft254. Epub 2013 Nov 5.
35	Quercetin downregulates Mcl-1 by acting on mRNA stability and protein degradation. Br J Cancer. 2011 Jul 12;105(2):221-30. doi: 10.1038/bjc.2011.229.
36	Docetaxel-induced apoptosis of human melanoma is mediated by activation of c-Jun NH2-terminal kinase and inhibited by the mitogen-activated protein kinase extracellular signal-regulated kinase 1/2 pathway. Clin Cancer Res. 2007 Feb 15;13(4):1308-14. doi: 10.1158/1078-0432.CCR-06-2216.
37	Anti-cancer properties of glucosamine-hydrochloride in YD-8 human oral cancer cells: Induction of the caspase-dependent apoptosis and down-regulation of HIF-1. Toxicol In Vitro. 2012 Feb;26(1):42-50. doi: 10.1016/j.tiv.2011.10.005. Epub 2011 Oct 13.
38	D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
39	The role of MITF and Mcl-1 proteins in the antiproliferative and proapoptotic effect of ciprofloxacin in amelanotic melanoma cells: In silico and in vitro study. Toxicol In Vitro. 2020 Aug;66:104884. doi: 10.1016/j.tiv.2020.104884. Epub 2020 May 8.
40	Blocking downstream signaling pathways in the context of HDAC inhibition promotes apoptosis preferentially in cells harboring mutant Ras. Oncotarget. 2016 Oct 25;7(43):69804-69815. doi: 10.18632/oncotarget.12001.
41	Apoptosis contributes to the cytotoxicity induced by amodiaquine and its major metabolite N-desethylamodiaquine in hepatic cells. Toxicol In Vitro. 2020 Feb;62:104669. doi: 10.1016/j.tiv.2019.104669. Epub 2019 Oct 16.
42	The mitochondria-independent cytotoxic effect of nelfinavir on leukemia cells can be enhanced by sorafenib-mediated mcl-1 downregulation and mitochondrial membrane destabilization. Mol Cancer. 2010 Jan 27;9:19. doi: 10.1186/1476-4598-9-19.
43	Ethacrynic acid and a derivative enhance apoptosis in arsenic trioxide-treated myeloid leukemia and lymphoma cells: the role of glutathione S-transferase p1-1. Clin Cancer Res. 2012 Dec 15;18(24):6690-701. doi: 10.1158/1078-0432.CCR-12-0770. Epub 2012 Oct 18.
44	[Homoharringtonine combined arsenic trioxide induced apoptosis in human multiple myeloma cell line RPMI 8226: an experimental research]. Zhongguo Zhong Xi Yi Jie He Za Zhi. 2013 Jun;33(6):834-9.
45	Matrix metalloproteinase-9 is involved in chronic lymphocytic leukemia cell response to fludarabine and arsenic trioxide. PLoS One. 2014 Jun 23;9(6):e99993. doi: 10.1371/journal.pone.0099993. eCollection 2014.
46	AMPK activation induced by promethazine increases NOXA expression and Beclin-1 phosphorylation and drives autophagy-associated apoptosis in chronic myeloid leukemia. Chem Biol Interact. 2020 Jan 5;315:108888. doi: 10.1016/j.cbi.2019.108888. Epub 2019 Nov 2.
47	1-(4-((5-chloro-4-((2-(isopropylsulfonyl)phenyl)amino)pyrimidin-2-yl)amino)-3-methoxyphenyl)-3-(2-(dimethylamino)ethyl)imidazolidin-2-one (ZX-42) inhibits cell proliferation and induces apoptosis via inhibiting ALK and its downstream pathways in Karpas299 cells. Toxicol Appl Pharmacol. 2022 Sep 1;450:116156. doi: 10.1016/j.taap.2022.116156. Epub 2022 Jul 6.
48	HSP90 Inhibitor PU-H71 in Combination with BH3-Mimetics in the Treatment of Acute Myeloid Leukemia. Curr Issues Mol Biol. 2023 Aug 23;45(9):7011-7026. doi: 10.3390/cimb45090443.
49	Uncovering the mechanism of Naoxintong capsule against hypertension based on network analysis and in?vitro experiments. Chem Biol Drug Des. 2024 Jan;103(1):e14440. doi: 10.1111/cbdd.14440.
50	Tetrandrine and cepharanthine induce apoptosis through caspase cascade regulation, cell cycle arrest, MAPK activation and PI3K/Akt/mTOR signal modification in glucocorticoid resistant human leukemia Jurkat T cells. Chem Biol Interact. 2019 Sep 1;310:108726. doi: 10.1016/j.cbi.2019.108726. Epub 2019 Jun 28.
51	Knockdown of Bcl-xL enhances growth-inhibiting and apoptosis-inducing effects of resveratrol and clofarabine in malignant mesothelioma H-2452 cells. J Korean Med Sci. 2014 Nov;29(11):1464-72. doi: 10.3346/jkms.2014.29.11.1464. Epub 2014 Nov 4.
52	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
53	Resveratrol-induced apoptosis is associated with Fas redistribution in the rafts and the formation of a death-inducing signaling complex in colon cancer cells. J Biol Chem. 2003 Oct 17;278(42):41482-90. doi: 10.1074/jbc.M304896200. Epub 2003 Aug 5.
54	Green tea component, catechin, induces apoptosis of human malignant B cells via production of reactive oxygen species. Clin Cancer Res. 2005 Aug 15;11(16):6040-9. doi: 10.1158/1078-0432.CCR-04-2273.
55	Styryl sulfonyl compounds inhibit translation of cyclin D1 in mantle cell lymphoma cells. Oncogene. 2009 Mar 26;28(12):1518-28. doi: 10.1038/onc.2008.502. Epub 2009 Feb 9.
56	RhoA GTPase inactivation by statins induces osteosarcoma cell apoptosis by inhibiting p42/p44-MAPKs-Bcl-2 signaling independently of BMP-2 and cell differentiation. Cell Death Differ. 2006 Nov;13(11):1845-56. doi: 10.1038/sj.cdd.4401873. Epub 2006 Feb 10.
57	Inhibition of PI3K signaling pathway enhances the chemosensitivity of APL cells to ATO: Proposing novel therapeutic potential for BKM120. Eur J Pharmacol. 2018 Dec 15;841:10-18. doi: 10.1016/j.ejphar.2018.10.007. Epub 2018 Oct 11.
58	Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.
59	Improved Preventive Effects of Combined Bioactive Compounds Present in Different Blueberry Varieties as Compared to Single Phytochemicals. Nutrients. 2018 Dec 29;11(1):61. doi: 10.3390/nu11010061.
60	Expression of endogenous retroviruses reflects increased usage of atypical enhancers in T cells. EMBO J. 2019 Jun 17;38(12):e101107. doi: 10.15252/embj.2018101107. Epub 2019 May 8.
61	Effects of antioxidants and caspase-3 inhibitor on the phenylethyl isothiocyanate-induced apoptotic signaling pathways in human PLC/PRF/5 cells. Eur J Pharmacol. 2005 Aug 22;518(2-3):96-106. doi: 10.1016/j.ejphar.2005.06.021.
62	Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
63	Analysis of expression of heat shock protein-90 (HSP90) and the effects of HSP90 inhibitor (17-AAG) in multiple myeloma. Leuk Lymphoma. 2006 Jul;47(7):1369-78. doi: 10.1080/10428190500472123.
64	Combination PI3K/MEK inhibition promotes tumor apoptosis and regression in PIK3CA wild-type, KRAS mutant colorectal cancer. Cancer Lett. 2014 Jun 1;347(2):204-11. doi: 10.1016/j.canlet.2014.02.018. Epub 2014 Feb 24.
65	Phosphoinositide 3-kinase (PI3K) pathway alterations are associated with histologic subtypes and are predictive of sensitivity to PI3K inhibitors in lung cancer preclinical models. Clin Cancer Res. 2012 Dec 15;18(24):6771-83. doi: 10.1158/1078-0432.CCR-12-2347. Epub 2012 Nov 7.
66	Flavopiridol down-regulates antiapoptotic proteins and sensitizes human breast cancer cells to epothilone B-induced apoptosis. Cancer Res. 2003 Jan 1;63(1):93-9.
67	Synergistic induction of cell death in haematological malignancies by combined phosphoinositide-3-kinase and BET bromodomain inhibition. Br J Haematol. 2015 Jul;170(2):275-8. doi: 10.1111/bjh.13283. Epub 2015 Jan 12.
68	Autophagic HuR mRNA degradation induces survivin and MCL1 downregulation in YM155-treated human leukemia cells. Toxicol Appl Pharmacol. 2020 Jan 15;387:114857. doi: 10.1016/j.taap.2019.114857. Epub 2019 Dec 16.
69	Protein kinase inhibitors flavopiridol and 7-hydroxy-staurosporine down-regulate antiapoptosis proteins in B-cell chronic lymphocytic leukemia. Blood. 2000 Jul 15;96(2):393-7.
70	In vitro antitumor mechanism of (E)-N-(2-methoxy-5-(((2,4,6-trimethoxystyryl)sulfonyl)methyl)pyridin-3-yl)methanesulfonamide. Mol Pharmacol. 2015 Jan;87(1):18-30. doi: 10.1124/mol.114.093245. Epub 2014 Oct 14.
71	The anti-apoptotic effect of leukotriene B4 in neutrophils: a role for phosphatidylinositol 3-kinase, extracellular signal-regulated kinase and Mcl-1. Cell Signal. 2006 Apr;18(4):479-87. doi: 10.1016/j.cellsig.2005.05.021. Epub 2005 Jun 20.
72	-(-)Gossypol promotes the apoptosis of bladder cancer cells in vitro. Pharmacol Res. 2008 Nov-Dec;58(5-6):323-31. doi: 10.1016/j.phrs.2008.09.005. Epub 2008 Sep 16.
73	IGF-1 receptor tyrosine kinase inhibition by the cyclolignan PPP induces G2/M-phase accumulation and apoptosis in multiple myeloma cells. Blood. 2006 Jan 15;107(2):669-78. doi: 10.1182/blood-2005-01-0306. Epub 2005 Sep 15.
74	The synergy of the XPO1 inhibitors combined with the BET inhibitor INCB057643 in high-grade B-cell lymphoma via downregulation of MYC expression. Sci Rep. 2023 Oct 29;13(1):18554. doi: 10.1038/s41598-023-45721-z.
75	Azaspirane (N-N-diethyl-8,8-dipropyl-2-azaspiro [4.5] decane-2-propanamine) inhibits human multiple myeloma cell growth in the bone marrow milieu in vitro and in vivo. Blood. 2005 Jun 1;105(11):4470-6. doi: 10.1182/blood-2004-09-3794. Epub 2005 Feb 10.
76	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
77	JQ1 suppresses tumor growth through downregulating LDHA in ovarian cancer. Oncotarget. 2015 Mar 30;6(9):6915-30. doi: 10.18632/oncotarget.3126.
78	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
79	Superior efficacy of cotreatment with BET protein inhibitor and BCL2 or MCL1 inhibitor against AML blast progenitor cells. Blood Cancer J. 2019 Jan 15;9(2):4. doi: 10.1038/s41408-018-0165-5.
80	Activation of mammalian target of rapamycin signaling promotes cell cycle progression and protects cells from apoptosis in mantle cell lymphoma. Am J Pathol. 2006 Dec;169(6):2171-80. doi: 10.2353/ajpath.2006.051078.
81	Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
82	Mechanisms of MCL-1 Protein Stability Induced by MCL-1 Antagonists in B-Cell Malignancies. Clin Cancer Res. 2023 Jan 17;29(2):446-457. doi: 10.1158/1078-0432.CCR-22-2088.
83	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
84	Increased cyclooxygenase-2 (COX-2): a potential role in the pathogenesis of lymphoma. Leuk Res. 2004 Feb;28(2):179-90. doi: 10.1016/s0145-2126(03)00183-8.
85	The genotoxicity potential of luteolin is enhanced by CYP1A1 and CYP1A2 in human lymphoblastoid TK6 cells. Toxicol Lett. 2021 Jun 15;344:58-68. doi: 10.1016/j.toxlet.2021.03.006. Epub 2021 Mar 13.
86	Ponatinib may overcome resistance of FLT3-ITD harbouring additional point mutations, notably the previously refractory F691I mutation. Br J Haematol. 2012 May;157(4):483-92. doi: 10.1111/j.1365-2141.2012.09085.x. Epub 2012 Mar 13.
87	Pentoxifylline induces apoptosis in vitro in cutaneous T cell lymphoma (HuT-78) and enhances FasL mediated killing by upregulating Fas expression. Biochem Pharmacol. 2009 Jan 1;77(1):30-45. doi: 10.1016/j.bcp.2008.09.018. Epub 2008 Sep 21.
88	Hydroxamic Acid and Benzoic Acid-Based STAT3 Inhibitors Suppress Human Glioma and Breast Cancer Phenotypes In Vitro and In Vivo. Cancer Res. 2016 Feb 1;76(3):652-63. doi: 10.1158/0008-5472.CAN-14-3558. Epub 2015 Jun 18.
89	Translational repression of MCL-1 couples stress-induced eIF2 alpha phosphorylation to mitochondrial apoptosis initiation. J Biol Chem. 2007 Aug 3;282(31):22551-62. doi: 10.1074/jbc.M702673200. Epub 2007 Jun 6.
90	An ERK-dependent pathway to Noxa expression regulates apoptosis by platinum-based chemotherapeutic drugs. Oncogene. 2010 Dec 9;29(49):6428-41. doi: 10.1038/onc.2010.380. Epub 2010 Aug 30.
91	SK-7041, a new histone deacetylase inhibitor, induces G2-M cell cycle arrest and apoptosis in pancreatic cancer cell lines. Cancer Lett. 2006 Jun 8;237(1):143-54. doi: 10.1016/j.canlet.2005.05.040. Epub 2005 Jul 11.
92	Emodin inhibits growth and induces apoptosis in an orthotopic hepatocellular carcinoma model by blocking activation of STAT3. Br J Pharmacol. 2013 Oct;170(4):807-21. doi: 10.1111/bph.12302.
93	ABT-737 resistance in B-cells isolated from chronic lymphocytic leukemia patients and leukemia cell lines is overcome by the pleiotropic kinase inhibitor quercetin through Mcl-1 down-regulation. Biochem Pharmacol. 2013 Apr 1;85(7):927-36. doi: 10.1016/j.bcp.2013.01.011. Epub 2013 Jan 24.
94	Antiapoptotic protein partners fortilin and MCL1 independently protect cells from 5-fluorouracil-induced cytotoxicity. J Biol Chem. 2004 Sep 24;279(39):40868-75. doi: 10.1074/jbc.M401454200. Epub 2004 Jul 15.
95	Role of bile salt in regulating Mcl-1 phosphorylation and chemoresistance in hepatocellular carcinoma cells. Mol Cancer. 2011 Apr 20;10:44. doi: 10.1186/1476-4598-10-44.
96	Apoptosis induced by the kinase inhibitor BAY 43-9006 in human leukemia cells involves down-regulation of Mcl-1 through inhibition of translation. J Biol Chem. 2005 Oct 21;280(42):35217-27. doi: 10.1074/jbc.M506551200. Epub 2005 Aug 18.
97	Mcl-1 antisense therapy chemosensitizes human melanoma in a SCID mouse xenotransplantation model. J Invest Dermatol. 2003 Jun;120(6):1081-6. doi: 10.1046/j.1523-1747.2003.12252.x.
98	Mechanisms of apoptosis sensitivity and resistance to the BH3 mimetic ABT-737 in acute myeloid leukemia. Cancer Cell. 2006 Nov;10(5):375-88. doi: 10.1016/j.ccr.2006.10.006.