Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3XD6U2)

• DOT Name: Immunoglobulin superfamily member 1 (IGSF1)
• Synonyms: IgSF1; Immunoglobulin-like domain-containing protein 1; Inhibin-binding protein; InhBP; Pituitary gland-specific factor 2; p120
• Gene Name: IGSF1
• Related Disease:
  Adult glioblastoma
  Colon cancer
  Colon carcinoma
  Cone-rod dystrophy 2
  Glioblastoma multiforme
  Thyroid cancer
  Thyroid gland carcinoma
  Thyroid tumor
  X-linked central congenital hypothyroidism with late-onset testicular enlargement
  Acromegaly
  Adenocarcinoma
  Arteriosclerosis
  Atherosclerosis
  Athyreosis
  Capillary malformation-arteriovenous malformation syndrome
  Central congenital hypothyroidism
  Congenital hypothyroidism
  Constipation
  Ductal carcinoma
  Hypopituitarism
  Hypothyroidism
  Invasive ductal breast carcinoma
  Lung cancer
  Lung carcinoma
  Mucinous adenocarcinoma
  Oral cancer
  Oral cavity carcinoma
  Pancreatic cancer
  Pituitary gigantism
  Prostate disease
  Squamous cell carcinoma
  Stroke
  Advanced cancer
  Glioma
• UniProt ID: IGSF1_HUMAN
• Pfam ID: PF13895
• Sequence:
  MTLDRPGEGATMLKTFTVLLFCIRMSLGMTSIVMDPQPELWIESNYPQAPWENITLWCRS
  PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKV
  LELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGT
  MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
  GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEANFFFQSLKIQDTGHYLCFYYD
  ASYRGSLLSDVLKIWVTDTFPKTWLLARPSAVVQMGQNVSLRCRGPVDGVGLALYKKGED
  KPLQFLDATSIDDNTSFFLNNVTYSDTGIYSCHYLLTWKTSIRMPSHNTVELMVVDKPPK
  PSLSAWPSTVFKLGKAITLQCRVSHPVLEFSLEWEERETFQKFSVNGDFIISNVDGKGTG
  TYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAIRLSLIMQLVALLLVVLWIR
  WKCRRLRIREAWLLGTAQGVTMLFIVTALLCCGLCNGVLIEETEIVMPTPKPELWAETNF
  PLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSYHC
  HSWEEMAVSEPSEALELVGTDILPKPVISASPTIRGQELQLRCKGWLAGMGFALYKEGEQ
  EPVQQLGAVGREAFFTIQRMEDKDEGNYSCRTHTEKRPFKWSEPSEPLELVIKEMYPKPF
  FKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIISVG
  IGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVILRCQGTFQ
  GMRFALLQEGAHVPLQFRSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSMPL
  MIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEGEATSMQLWGSTSND
  GAFPITNISGTSMGRYSCCYHPDWTSSIKIQPSNTLELLVTGLLPKPSLLAQPGPMVAPG
  ENMTLQCQGELPDSTFVLLKEGAQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYLDS
  TPFAASNHSDSLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLEHDGEE
  APQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDPLELVGAAGPVAQECTVG
  NIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPANS
  PSSTSQRISVELPVPI
• Function: Seems to be a coreceptor in inhibin signaling, but seems not to be a high-affinity inhibin receptor. Antagonizes activin A signaling in the presence or absence of inhibin B. Necessary to mediate a specific antagonistic effect of inhibin B on activin-stimulated transcription.
• Tissue Specificity: Highly expressed in pancreas, testis and fetal liver. Moderately expressed in heart, prostate and small intestine. Expressed at very low levels in brain, thymus, ovary, colon, fetal lung and fetal kidney. Expressed in muscle. Isoform 3 is expressed in pituitary gland.
• KEGG Pathway: TGF-beta sig.ling pathway (hsa04350)

Molecular Interaction Atlas (MIA) of This DOT

34 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Colon cancer	DISVC52G	Definitive	Altered Expression	[2]
Colon carcinoma	DISJYKUO	Definitive	Altered Expression	[2]
Cone-rod dystrophy 2	DISX2RWY	Definitive	Biomarker	[3]
Glioblastoma multiforme	DISK8246	Definitive	Biomarker	[1]
Thyroid cancer	DIS3VLDH	Definitive	Altered Expression	[4]
Thyroid gland carcinoma	DISMNGZ0	Definitive	Altered Expression	[4]
Thyroid tumor	DISLVKMD	Definitive	Altered Expression	[4]
X-linked central congenital hypothyroidism with late-onset testicular enlargement	DISWSUUL	Definitive	X-linked	[5]
Acromegaly	DISCC73U	Strong	Biomarker	[6]
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[7]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[8]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[8]
Athyreosis	DISBHHCU	Strong	Biomarker	[9]
Capillary malformation-arteriovenous malformation syndrome	DISMN03Q	Strong	Genetic Variation	[10]
Central congenital hypothyroidism	DIS6FWEW	Strong	Biomarker	[11]
Congenital hypothyroidism	DISL5XVU	Strong	Biomarker	[9]
Constipation	DISRQXWI	Strong	Genetic Variation	[11]
Ductal carcinoma	DIS15EA5	Strong	Biomarker	[12]
Hypopituitarism	DIS1QT3G	Strong	Genetic Variation	[13]
Hypothyroidism	DISR0H6D	Strong	Biomarker	[14]
Invasive ductal breast carcinoma	DIS43J58	Strong	Altered Expression	[15]
Lung cancer	DISCM4YA	Strong	Altered Expression	[7]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[7]
Mucinous adenocarcinoma	DISKNFE8	Strong	Biomarker	[16]
Oral cancer	DISLD42D	Strong	Biomarker	[17]
Oral cavity carcinoma	DISZXMVL	Strong	Biomarker	[17]
Pancreatic cancer	DISJC981	Strong	Biomarker	[18]
Pituitary gigantism	DISIUHNT	Strong	Biomarker	[6]
Prostate disease	DISFVG19	Strong	Altered Expression	[19]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[7]
Stroke	DISX6UHX	Strong	Biomarker	[8]
Advanced cancer	DISAT1Z9	moderate	Altered Expression	[2]
Glioma	DIS5RPEH	Limited	Biomarker	[20]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[21]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[22]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[23]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[25]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[26]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[27]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[28]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[29]
Testosterone Undecanoate	DMZO10Y	Approved	Testosterone Undecanoate decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[34]
Acetaldehyde	DMJFKG4	Investigative	Acetaldehyde increases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[35]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride decreases the expression of Immunoglobulin superfamily member 1 (IGSF1).	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Immunoglobulin superfamily member 1 (IGSF1).	[33]

References

• [1] Interleukin-8 Secreted by Glioblastoma Cells Induces Microvascular Hyperpermeability Through NO Signaling Involving S-Nitrosylation of VE-Cadherin and p120 in Endothelial Cells.Front Physiol. 2019 Aug 8;10:988. doi: 10.3389/fphys.2019.00988. eCollection 2019.
• [2] miR-223 promotes colon cancer by directly targeting p120 catenin.Oncotarget. 2017 Jul 25;8(38):63764-63779. doi: 10.18632/oncotarget.19541. eCollection 2017 Sep 8.
• [3] LINGO-1 and AMIGO3, potential therapeutic targets for neurological and dysmyelinating disorders?.Neural Regen Res. 2017 Aug;12(8):1247-1251. doi: 10.4103/1673-5374.213538.
• [4] IGSF1: A novel oncogene regulates the thyroid cancer progression.Cell Biochem Funct. 2019 Oct;37(7):516-524. doi: 10.1002/cbf.3426. Epub 2019 Jul 25.
• [5] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [6] Is IGSF1 involved in human pituitary tumor formation?.Endocr Relat Cancer. 2015 Feb;22(1):47-54. doi: 10.1530/ERC-14-0465. Epub 2014 Dec 19.
• [7] Expression of nucleolar protein p120 in human lung cancer: difference in histological types as a marker for proliferation.Clin Cancer Res. 1997 Oct;3(10):1873-7.
• [8] p120 inhibits LPS/TNF-induced endothelial Ang2 synthesis and release in an NF-B independent fashion.Cytokine. 2019 Nov;123:154786. doi: 10.1016/j.cyto.2019.154786. Epub 2019 Jul 26.
• [9] Loss-of-function mutations in IGSF1 cause an X-linked syndrome of central hypothyroidism and testicular enlargement. Nat Genet. 2012 Dec;44(12):1375-81. doi: 10.1038/ng.2453. Epub 2012 Nov 11.
• [10] RASA1 regulates the function of lymphatic vessel valves in mice.J Clin Invest. 2017 Jun 30;127(7):2569-2585. doi: 10.1172/JCI89607. Epub 2017 May 22.
• [11] A Japanese patient with congenital central hypothyroidism caused by a novel IGSF1 mutation.J Pediatr Endocrinol Metab. 2018 Mar 28;31(3):355-359. doi: 10.1515/jpem-2017-0144.
• [12] Further evidence that E-cadherin is not a tumour suppressor gene in invasive ductal carcinoma of the breast: an immunohistochemical study.Histopathology. 2013 Apr;62(5):695-701. doi: 10.1111/his.12066. Epub 2013 Jan 24.
• [13] Identification of an IGSF1-specific deletion in a five-generation pedigree with X-linked Central Hypothyroidism without macroorchidism.Clin Endocrinol (Oxf). 2016 Oct;85(4):609-15. doi: 10.1111/cen.13094. Epub 2016 Jun 9.
• [14] X-linked duplication copy number variation in a familial overgrowth condition.Am J Med Genet C Semin Med Genet. 2019 Dec;181(4):644-649. doi: 10.1002/ajmg.c.31756. Epub 2019 Nov 25.
• [15] Correlation between E-cadherin and p120 expression in invasive ductal breast cancer with a lobular component and MRI findings.Virchows Arch. 2017 Dec;471(6):707-712. doi: 10.1007/s00428-017-2203-2. Epub 2017 Aug 4.
• [16] Invasive lobular carcinoma with extracellular mucin production and HER-2 overexpression: a case report and further case studies.Diagn Pathol. 2010 Jun 15;5:36. doi: 10.1186/1746-1596-5-36.
• [17] Nucleolar protein p120 expression in oral carcinoma.Anticancer Res. 1999 Mar-Apr;19(2B):1423-6.
• [18] Up-regulation, nuclear import, and tumor growth stimulation of the adhesion protein p120 in pancreatic cancer.Gastroenterology. 2003 Apr;124(4):949-60. doi: 10.1053/gast.2003.50142.
• [19] A novel splice variant of the nuclear coactivator p120 functions strongly for androgen receptor: characteristic expression in prostate disease.Endocr J. 2008 Aug;55(4):657-65. doi: 10.1507/endocrj.k07e-133. Epub 2008 Jun 18.
• [20] Expression of p120 nucleolar proliferating antigen in human gliomas and growth suppression of glioma cells by p120 ribozyme vector.Int J Oncol. 1999 Mar;14(3):417-24. doi: 10.3892/ijo.14.3.417.
• [21] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [22] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [23] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [24] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] Long-term estrogen exposure promotes carcinogen bioactivation, induces persistent changes in gene expression, and enhances the tumorigenicity of MCF-7 human breast cancer cells. Toxicol Appl Pharmacol. 2009 Nov 1;240(3):355-66.
• [27] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [28] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [29] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [30] Levonorgestrel enhances spermatogenesis suppression by testosterone with greater alteration in testicular gene expression in men. Biol Reprod. 2009 Mar;80(3):484-92.
• [31] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [32] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [33] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [34] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
• [35] Transcriptome profile analysis of saturated aliphatic aldehydes reveals carbon number-specific molecules involved in pulmonary toxicity. Chem Res Toxicol. 2014 Aug 18;27(8):1362-70.
• [36] Classification of heavy-metal toxicity by human DNA microarray analysis. Environ Sci Technol. 2007 May 15;41(10):3769-74.