Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT43LYEZ)

• DOT Name: Retinoid-inducible serine carboxypeptidase (SCPEP1)
• Synonyms: EC 3.4.16.-; Serine carboxypeptidase 1
• Gene Name: SCPEP1
• Related Disease:
  Acute myelogenous leukaemia
  Breast cancer
  Chronic pancreatitis
  Clear cell renal carcinoma
  Depression
  High blood pressure
  Hyperglycemia
  Liver cancer
  Major depressive disorder
  Pancreatic cancer
  Plasma cell myeloma
  Precancerous condition
  Primary cutaneous T-cell lymphoma
  Progressive multifocal leukoencephalopathy
  Schizophrenia
  Bone osteosarcoma
  Breast carcinoma
  Hepatocellular carcinoma
  Osteosarcoma
  Testicular cancer
  Helicoid peripapillary chorioretinal degeneration
  Type-1/2 diabetes
• UniProt ID: RISC_HUMAN
• EC Number: 3.4.16.-
• Pfam ID: PF00450
• Sequence:
  MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATN
  SCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGT
  GFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLEL
  YKAIQRGTIKCNFAGVALGDSWISPVDSVLSWGPYLYSMSLLEDKGLAEVSKVAEQVLNA
  VNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTSTMESSLEFTQSHLVCLCQRH
  VRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVISIVDELLEAG
  INVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKN
  LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE
• Function: May be involved in vascular wall and kidney homeostasis.

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[2]
Chronic pancreatitis	DISBUOMJ	Strong	Altered Expression	[3]
Clear cell renal carcinoma	DISBXRFJ	Strong	Altered Expression	[4]
Depression	DIS3XJ69	Strong	Biomarker	[5]
High blood pressure	DISY2OHH	Strong	Genetic Variation	[6]
Hyperglycemia	DIS0BZB5	Strong	Biomarker	[7]
Liver cancer	DISDE4BI	Strong	Biomarker	[8]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[5]
Pancreatic cancer	DISJC981	Strong	Biomarker	[3]
Plasma cell myeloma	DIS0DFZ0	Strong	Biomarker	[1]
Precancerous condition	DISV06FL	Strong	Biomarker	[3]
Primary cutaneous T-cell lymphoma	DIS35WVW	Strong	Biomarker	[9]
Progressive multifocal leukoencephalopathy	DISX02WS	Strong	Biomarker	[4]
Schizophrenia	DISSRV2N	Strong	Genetic Variation	[10]
Bone osteosarcoma	DIST1004	moderate	Genetic Variation	[11]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[13]
Osteosarcoma	DISLQ7E2	moderate	Genetic Variation	[11]
Testicular cancer	DIS6HNYO	moderate	Altered Expression	[14]
Helicoid peripapillary chorioretinal degeneration	DISFSS5N	Limited	Genetic Variation	[15]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[16]

19 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[17]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[18]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[19]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[22]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[23]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[24]
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[25]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[26]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[27]
Testosterone enanthate	DMB6871	Approved	Testosterone enanthate affects the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[28]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[29]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[32]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[33]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[34]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[35]
Lithium chloride	DMHYLQ2	Investigative	Lithium chloride increases the expression of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[36]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Retinoid-inducible serine carboxypeptidase (SCPEP1).	[31]

References

• [1] Expression of testicular genes in haematological malignancies.Br J Cancer. 1999 Dec;81(7):1162-4. doi: 10.1038/sj.bjc.6690824.
• [2] Cancer exosomes perform cell-independent microRNA biogenesis and promote tumorigenesis.Cancer Cell. 2014 Nov 10;26(5):707-21. doi: 10.1016/j.ccell.2014.09.005. Epub 2014 Oct 23.
• [3] Expression of cancer testis antigens in pancreatic carcinoma cell lines, pancreatic adenocarcinoma and chronic pancreatitis.Int J Cancer. 2004 Apr 20;109(4):568-75. doi: 10.1002/ijc.20006.
• [4] SCP phosphatases suppress renal cell carcinoma by stabilizing PML and inhibiting mTOR/HIF signaling.Cancer Res. 2014 Dec 1;74(23):6935-46. doi: 10.1158/0008-5472.CAN-14-1330. Epub 2014 Oct 7.
• [5] Psychometric properties of the 10-item Connor-Davidson Resilience Scale (CD-RISC-10) in Chinese undergraduates and depressive patients.J Affect Disord. 2020 Jan 15;261:211-220. doi: 10.1016/j.jad.2019.10.018. Epub 2019 Oct 12.
• [6] Gamma-glutamyltransferase, fatty liver index and hepatic insulin resistance are associated with incident hypertension in two longitudinal studies.J Hypertens. 2017 Mar;35(3):493-500. doi: 10.1097/HJH.0000000000001204.
• [7] Physicochemical properties of polysaccharides separated from Camellia oleifera Abel seed cake and its hypoglycemic activity on streptozotocin-induced diabetic mice.Int J Biol Macromol. 2019 Mar 15;125:1075-1083. doi: 10.1016/j.ijbiomac.2018.12.059. Epub 2018 Dec 5.
• [8] SCP1 regulates c-Myc stability and functions through dephosphorylating c-Myc Ser62.Oncogene. 2016 Jan 28;35(4):491-500. doi: 10.1038/onc.2015.106. Epub 2015 Apr 20.
• [9] Expression of cancer/testis antigens in cutaneous T cell lymphomas.Int J Cancer. 2002 Feb 10;97(5):668-70. doi: 10.1002/ijc.1643.
• [10] Brain-behaviour relationships in people at high genetic risk of schizophrenia.Neuroimage. 2006 Oct 15;33(1):275-85. doi: 10.1016/j.neuroimage.2006.06.031. Epub 2006 Aug 22.
• [11] Polymorphisms in miRNA processing genes and their role in osteosarcoma risk.Pediatr Blood Cancer. 2015 May;62(5):766-9. doi: 10.1002/pbc.25416. Epub 2015 Feb 7.
• [12] Breast carcinoma cells modulate the chemoattractive activity of human bone marrow-derived mesenchymal stromal cells by interfering with CXCL12.Int J Cancer. 2015 Jan 1;136(1):44-54. doi: 10.1002/ijc.28960. Epub 2014 May 20.
• [13] Oncogenic Role of SND1 in Development and Progression of Hepatocellular Carcinoma.Cancer Res. 2017 Jun 15;77(12):3306-3316. doi: 10.1158/0008-5472.CAN-17-0298. Epub 2017 Apr 20.
• [14] Prospective study on the expression of cancer testis genes and antibody responses in 100 consecutive patients with primary breast cancer.Int J Cancer. 2006 Feb 1;118(3):696-703. doi: 10.1002/ijc.21352.
• [15] Cloning and characterization of the first serine carboxypeptidase from a plant parasitic nematode, Radopholus similis.Sci Rep. 2017 Jul 6;7(1):4815. doi: 10.1038/s41598-017-05093-7.
• [16] Insulin resistance and -cell function in smokers: results from the EGIR-RISC European multicentre study.Diabet Med. 2017 Feb;34(2):223-228. doi: 10.1111/dme.13172. Epub 2016 Jul 28.
• [17] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [18] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [19] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [20] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [21] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [24] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [25] Gene microarray analysis of human renal cell carcinoma: the effects of HDAC inhibition and retinoid treatment. Cancer Biol Ther. 2008 Oct;7(10):1607-18.
• [26] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [27] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [28] Transcriptional profiling of testosterone-regulated genes in the skeletal muscle of human immunodeficiency virus-infected men experiencing weight loss. J Clin Endocrinol Metab. 2007 Jul;92(7):2793-802. doi: 10.1210/jc.2006-2722. Epub 2007 Apr 17.
• [29] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [30] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [33] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [34] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [35] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [36] Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.