Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5WF17M)

DOT Name Homeobox protein Hox-C10 (HOXC10)
Synonyms Homeobox protein Hox-3I
Gene Name HOXC10
Related Disease
Adult glioblastoma ( )
Bone osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Gastric cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
leukaemia ( )
Leukemia ( )
Neoplasm ( )
Obesity ( )
Osteosarcoma ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Plasma cell myeloma ( )
Thyroid cancer ( )
Thyroid gland carcinoma ( )
Thyroid tumor ( )
Advanced cancer ( )
Cervical cancer ( )
Cervical carcinoma ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
UniProt ID
HXC10_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MTCPRNVTPNSYAEPLAAPGGGERYSRSAGMYMQSGSDFNCGVMRGCGLAPSLSKRDEGS
SPSLALNTYPSYLSQLDSWGDPKAAYRLEQPVGRPLSSCSYPPSVKEENVCCMYSAEKRA
KSGPEAALYSHPLPESCLGEHEVPVPSYYRASPSYSALDKTPHCSGANDFEAPFEQRASL
NPRAEHLESPQLGGKVSFPETPKSDSQTPSPNEIKTEQSLAGPKGSPSESEKERAKAADS
SPDTSDNEAKEEIKAENTTGNWLTAKSGRKKRCPYTKHQTLELEKEFLFNMYLTRERRLE
ISKTINLTDRQVKIWFQNRRMKLKKMNRENRIRELTSNFNFT
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.

Molecular Interaction Atlas (MIA) of This DOT

25 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Definitive Altered Expression [1]
Bone osteosarcoma DIST1004 Strong Altered Expression [2]
Breast cancer DIS7DPX1 Strong Biomarker [3]
Breast carcinoma DIS2UE88 Strong Biomarker [3]
Breast neoplasm DISNGJLM Strong Biomarker [4]
Gastric cancer DISXGOUK Strong Altered Expression [5]
Glioblastoma multiforme DISK8246 Strong Biomarker [1]
Glioma DIS5RPEH Strong Biomarker [6]
leukaemia DISS7D1V Strong Biomarker [7]
Leukemia DISNAKFL Strong Biomarker [7]
Neoplasm DISZKGEW Strong Altered Expression [6]
Obesity DIS47Y1K Strong Biomarker [8]
Osteosarcoma DISLQ7E2 Strong Altered Expression [2]
Squamous cell carcinoma DISQVIFL Strong Altered Expression [9]
Stomach cancer DISKIJSX Strong Altered Expression [5]
Plasma cell myeloma DIS0DFZ0 moderate Altered Expression [10]
Thyroid cancer DIS3VLDH moderate Biomarker [11]
Thyroid gland carcinoma DISMNGZ0 moderate Biomarker [11]
Thyroid tumor DISLVKMD moderate Biomarker [11]
Advanced cancer DISAT1Z9 Limited Biomarker [9]
Cervical cancer DISFSHPF Limited Biomarker [12]
Cervical carcinoma DIST4S00 Limited Biomarker [12]
Lung adenocarcinoma DISD51WR Limited Biomarker [13]
Lung cancer DISCM4YA Limited Biomarker [13]
Lung carcinoma DISTR26C Limited Biomarker [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 25 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Homeobox protein Hox-C10 (HOXC10). [14]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Homeobox protein Hox-C10 (HOXC10). [20]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of Homeobox protein Hox-C10 (HOXC10). [23]
------------------------------------------------------------------------------------
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Homeobox protein Hox-C10 (HOXC10). [15]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Homeobox protein Hox-C10 (HOXC10). [16]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Homeobox protein Hox-C10 (HOXC10). [17]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Homeobox protein Hox-C10 (HOXC10). [18]
Beta-carotene DM0RXBT Approved Beta-carotene increases the expression of Homeobox protein Hox-C10 (HOXC10). [19]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Homeobox protein Hox-C10 (HOXC10). [21]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Homeobox protein Hox-C10 (HOXC10). [22]
GALLICACID DM6Y3A0 Investigative GALLICACID decreases the expression of Homeobox protein Hox-C10 (HOXC10). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)

References

1 Overexpression of HOXC10 promotes glioblastoma cell progression to a poor prognosis via the PI3K/AKT signalling pathway.J Drug Target. 2019 Jan;27(1):60-66. doi: 10.1080/1061186X.2018.1473408. Epub 2018 Aug 6.
2 Homeobox C10 knockdown suppresses cell proliferation and promotes cell apoptosis in osteosarcoma cells through regulating caspase 3.Onco Targets Ther. 2018 Jan 22;11:473-482. doi: 10.2147/OTT.S143440. eCollection 2018.
3 HOXC10 Expression Supports the Development of Chemotherapy Resistance by Fine Tuning DNA Repair in Breast Cancer Cells.Cancer Res. 2016 Aug 1;76(15):4443-56. doi: 10.1158/0008-5472.CAN-16-0774. Epub 2016 Jun 14.
4 Epigenetic reprogramming of HOXC10 in endocrine-resistant breast cancer.Sci Transl Med. 2014 Mar 26;6(229):229ra41. doi: 10.1126/scitranslmed.3008326.
5 Homeobox C10 Influences on the Malignant Phenotype of Gastric Cancer Cell Lines and its Elevated Expression Positively Correlates with Recurrence and Poor Survival.Ann Surg Oncol. 2019 May;26(5):1535-1543. doi: 10.1245/s10434-019-07166-5. Epub 2019 Jan 23.
6 HOXC10 promotes proliferation and invasion and induces immunosuppressive gene expression in glioma.FEBS J. 2018 Jun;285(12):2278-2291. doi: 10.1111/febs.14476. Epub 2018 May 25.
7 HOXC10 is overexpressed in breast cancer and transcriptionally regulated by estrogen via involvement of histone methylases MLL3 and MLL4.J Mol Endocrinol. 2012 Jan 25;48(1):61-75. doi: 10.1530/JME-11-0078. Print 2012 Feb.
8 Fat depot-specific expression of HOXC9 and HOXC10 may contribute to adverse fat distribution and related metabolic traits.Obesity (Silver Spring). 2016 Jan;24(1):51-9. doi: 10.1002/oby.21317. Epub 2015 Dec 9.
9 HOXC10 promotes migration and invasion via the WNT-EMT signaling pathway in oral squamous cell carcinoma.J Cancer. 2019 Jul 25;10(19):4540-4551. doi: 10.7150/jca.30645. eCollection 2019.
10 HOXC10 Regulates Osteogenesis of Mesenchymal Stromal Cells Through Interaction with Its Natural Antisense Transcript lncHOXC-AS3.Stem Cells. 2019 Feb;37(2):247-256. doi: 10.1002/stem.2925. Epub 2018 Dec 2.
11 HOXC10 up-regulation contributes to human thyroid cancer and indicates poor survival outcome.Mol Biosyst. 2015 Nov;11(11):2946-54. doi: 10.1039/c5mb00253b.
12 Gene expression analysis of preinvasive and invasive cervical squamous cell carcinomas identifies HOXC10 as a key mediator of invasion.Cancer Res. 2007 Nov 1;67(21):10163-72. doi: 10.1158/0008-5472.CAN-07-2056.
13 HOXC10 Promotes the Metastasis of Human Lung Adenocarcinoma and Indicates Poor Survival Outcome.Front Physiol. 2017 Aug 2;8:557. doi: 10.3389/fphys.2017.00557. eCollection 2017.
14 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
15 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
16 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
17 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
18 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
19 Beta-carotene and apocarotenals promote retinoid signaling in BEAS-2B human bronchioepithelial cells. Arch Biochem Biophys. 2006 Nov 1;455(1):48-60.
20 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
21 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
22 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
23 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
24 Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.