Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT67E3Q1)

DOT Name Embigin (EMB)
Gene Name EMB
Related Disease
Allergic contact dermatitis ( )
Advanced cancer ( )
Anemia ( )
Cardiac failure ( )
Chronic fatigue syndrome ( )
Congestive heart failure ( )
Fibromyalgia ( )
Glomerulonephritis ( )
Hepatitis ( )
Hepatitis A virus infection ( )
Hepatitis C virus infection ( )
Hepatocellular carcinoma ( )
Hereditary nonpolyposis colon cancer ( )
HIV infectious disease ( )
leukaemia ( )
Lynch syndrome ( )
Multi-drug resistant tuberculosis ( )
Pneumothorax ( )
Prostate cancer ( )
Prostate neoplasm ( )
Sexually transmitted infection ( )
Tuberculosis ( )
Breast cancer ( )
Breast carcinoma ( )
Breast neoplasm ( )
Cardiomyopathy ( )
Leukemia ( )
Lupus nephritis ( )
Pancreatic cancer ( )
Pancreatic ductal carcinoma ( )
UniProt ID
EMB_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7YR5
Pfam ID
PF07679
Sequence
MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESH
NISLTEHSSMPVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATG
STLYTQYRFTIINSKQMGSYSCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTVLTC
KCQNCFPLNWTWYSSNGSVKVPVGVQMNKYVINGTYANETKLKITQLLEEDGESYWCRAL
FQLGESEEHIELVVLSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFEQ
IEQLKSDDSNGIENNVPRHRKNESLGQ
Function
Plays a role in the outgrowth of motoneurons and in the formation of neuromuscular junctions. Following muscle denervation, promotes nerve terminal sprouting and the formation of additional acetylcholine receptor clusters at synaptic sites without affecting terminal Schwann cell number or morphology. Delays the retraction of terminal sprouts following re-innervation of denervated endplates. May play a role in targeting the monocarboxylate transporters SLC16A1, SLC16A6 and SLC16A7 to the cell membrane.
Reactome Pathway
Proton-coupled monocarboxylate transport (R-HSA-433692 )

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Allergic contact dermatitis DISFFVF9 Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Biomarker [2]
Anemia DISTVL0C Strong Biomarker [3]
Cardiac failure DISDC067 Strong Biomarker [4]
Chronic fatigue syndrome DIS34WJ5 Strong Biomarker [5]
Congestive heart failure DIS32MEA Strong Biomarker [4]
Fibromyalgia DISZJDS2 Strong Genetic Variation [5]
Glomerulonephritis DISPZIQ3 Strong Altered Expression [6]
Hepatitis DISXXX35 Strong Biomarker [7]
Hepatitis A virus infection DISUMFQV Strong Biomarker [7]
Hepatitis C virus infection DISQ0M8R Strong Genetic Variation [8]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [9]
Hereditary nonpolyposis colon cancer DISPA49R Strong Biomarker [10]
HIV infectious disease DISO97HC Strong Biomarker [11]
leukaemia DISS7D1V Strong Biomarker [12]
Lynch syndrome DIS3IW5F Strong Biomarker [10]
Multi-drug resistant tuberculosis DIS1A2CS Strong Biomarker [13]
Pneumothorax DISP86H1 Strong Biomarker [14]
Prostate cancer DISF190Y Strong Biomarker [2]
Prostate neoplasm DISHDKGQ Strong Biomarker [2]
Sexually transmitted infection DISIVIAL Strong Biomarker [15]
Tuberculosis DIS2YIMD Strong Genetic Variation [16]
Breast cancer DIS7DPX1 Limited Biomarker [17]
Breast carcinoma DIS2UE88 Limited Biomarker [17]
Breast neoplasm DISNGJLM Limited Biomarker [17]
Cardiomyopathy DISUPZRG Limited Biomarker [18]
Leukemia DISNAKFL Limited Biomarker [19]
Lupus nephritis DISCVGPZ Limited Biomarker [20]
Pancreatic cancer DISJC981 Limited Biomarker [21]
Pancreatic ductal carcinoma DIS26F9Q Limited Altered Expression [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 30 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
10 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Embigin (EMB). [22]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Embigin (EMB). [23]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Embigin (EMB). [24]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Embigin (EMB). [25]
DNCB DMDTVYC Phase 2 DNCB decreases the expression of Embigin (EMB). [1]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Embigin (EMB). [28]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Embigin (EMB). [29]
Eugenol DM7US1H Patented Eugenol decreases the expression of Embigin (EMB). [1]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Embigin (EMB). [30]
methyl p-hydroxybenzoate DMO58UW Investigative methyl p-hydroxybenzoate decreases the expression of Embigin (EMB). [31]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Embigin (EMB). [27]
------------------------------------------------------------------------------------

References

1 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
2 Embigin Promotes Prostate Cancer Progression by S100A4-Dependent and-Independent Mechanisms.Cancers (Basel). 2018 Jul 23;10(7):239. doi: 10.3390/cancers10070239.
3 Retrovirus-induced feline pure red blood cell aplasia: pathogenesis and response to suramin.Blood. 1991 Apr 1;77(7):1442-51.
4 Immunomodulatory treatment for lymphocytic myocarditis-a systematic review and meta-analysis.Heart Fail Rev. 2018 Jul;23(4):573-581. doi: 10.1007/s10741-018-9709-9.
5 Prevalence of xenotropic murine leukemia virus-related virus infection in different risk populations in Spain.AIDS Res Hum Retroviruses. 2012 Sep;28(9):1089-94. doi: 10.1089/AID.2011.0149. Epub 2012 Feb 21.
6 Enforced Bcl-2 expression in B lymphocytes induces rheumatoid factor and anti-DNA production, but the Yaa mutation promotes only anti-DNA production.Eur J Immunol. 2004 Apr;34(4):1077-84. doi: 10.1002/eji.200424859.
7 Genetic alterations of the putative envelope proteins encoding region of the hepatitis C virus in the progression to relapsed phase from acute hepatitis: humoral immune response to hypervariable region 1.Int J Cancer. 1994 Jun 1;57(5):664-70. doi: 10.1002/ijc.2910570509.
8 Genetic alteration of the hepatitis C virus hypervariable region obtained from an asymptomatic carrier.Int J Cancer. 1994 Jan 15;56(2):204-7. doi: 10.1002/ijc.2910560210.
9 Marked sequence diversity in the putative envelope proteins of hepatitis C viruses.Virus Res. 1992 Feb;22(2):107-23. doi: 10.1016/0168-1702(92)90038-b.
10 Immunohistochemistry for mismatch repair protein deficiency in endometrioid endometrial carcinoma yields equivalent results when performed on endometrial biopsy/curettage or hysterectomy specimens.Gynecol Oncol. 2018 Jun;149(3):570-574. doi: 10.1016/j.ygyno.2018.04.005. Epub 2018 Apr 13.
11 Human Immunodeficiency Virus C.1086 Envelope gp140 Protein Boosts following DNA/Modified Vaccinia Virus Ankara Vaccination Fail To Enhance Heterologous Anti-V1V2 Antibody Response and Protection against Clade C Simian-Human Immunodeficiency Virus Challenge.J Virol. 2019 Sep 30;93(20):e00934-19. doi: 10.1128/JVI.00934-19. Print 2019 Oct 15.
12 Enhanced T cell engraftment after retroviral delivery of an antiviral gene in HIV-infected individuals.Proc Natl Acad Sci U S A. 1998 Feb 3;95(3):1201-6. doi: 10.1073/pnas.95.3.1201.
13 Molecular Screening Versus Phenotypic Susceptibility Testing of Multidrug-Resistant Mycobacterium tuberculosis Isolates for Streptomycin and Ethambutol.Microb Drug Resist. 2018 Sep;24(7):923-931. doi: 10.1089/mdr.2017.0294. Epub 2018 Jan 16.
14 Comparison of Utilization Trends, Indications, and Complications of Endomyocardial Biopsy in Native Versus Donor Hearts (from the Nationwide Inpatient Sample 2002 to 2014).Am J Cardiol. 2018 Feb 1;121(3):356-363. doi: 10.1016/j.amjcard.2017.10.021. Epub 2017 Oct 31.
15 Seroprevalence of xenotropic murine leukemia virus-related virus in normal and retrovirus-infected blood donors.Transfusion. 2012 Feb;52(2):307-16. doi: 10.1111/j.1537-2995.2011.03395.x. Epub 2011 Oct 24.
16 Automated broth-based systems versus the MYCOTB plate for antimicrobial susceptibility testing of the Mycobacterium tuberculosis complex: challenges in interpretation.Diagn Microbiol Infect Dis. 2018 May;91(1):38-41. doi: 10.1016/j.diagmicrobio.2018.01.002. Epub 2018 Jan 6.
17 Embigin, regulated by HOXC8, plays a suppressive role in breast tumorigenesis.Oncotarget. 2015 Sep 15;6(27):23496-509. doi: 10.18632/oncotarget.4360.
18 Feasibility of Performing Radiofrequency Catheter Ablation and Endomyocardial Biopsy in the Same Setting.Am J Cardiol. 2018 Jun 1;121(11):1373-1379. doi: 10.1016/j.amjcard.2018.02.020. Epub 2018 Mar 5.
19 Feline Lymphoma and a High Correlation with Feline Leukaemia Virus Infection in Brazil.J Comp Pathol. 2019 Jan;166:20-28. doi: 10.1016/j.jcpa.2018.10.171. Epub 2018 Nov 29.
20 The Sgp3 locus derived from the 129 strain is responsible for enhanced endogenous retroviral expression in macroH2A1-deficient mice.J Autoimmun. 2010 Dec;35(4):398-403. doi: 10.1016/j.jaut.2010.08.003. Epub 2010 Sep 15.
21 Embigin is overexpressed in pancreatic ductal adenocarcinoma and regulates cell motility through epithelial to mesenchymal transition via the TGF- pathway.Mol Carcinog. 2016 May;55(5):633-45. doi: 10.1002/mc.22309. Epub 2015 Mar 14.
22 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
23 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
24 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
25 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
26 Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
27 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
28 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
29 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
30 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
31 Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.