Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT884QY9)

• DOT Name: Acyl-CoA-binding protein (DBI)
• Synonyms: ACBP; Diazepam-binding inhibitor; DBI; Endozepine; EP
• Gene Name: DBI
• Related Disease:
  Angelman syndrome
  Parkinson disease
  Achalasia
  Adult glioblastoma
  Alzheimer disease
  Anemia
  Anxiety disorder
  Autism spectrum disorder
  Brain neoplasm
  Chronic fatigue syndrome
  Depression
  Glioblastoma multiforme
  Language disorder
  Leiomyoma
  Neoplasm
  Obesity
  Pervasive developmental disorder
  Prostate cancer
  Prostate carcinoma
  Uterine fibroids
  Zellweger spectrum disorders
  Alcohol dependence
  Anorexia nervosa cachexia
  Anxiety
  Carcinoma
  Hepatic encephalopathy
  High blood pressure
  Non-insulin dependent diabetes
  Undifferentiated carcinoma
• UniProt ID: ACBP_HUMAN
• PDB ID: 2CB8; 2FJ9
• Pfam ID: PF00887
• Sequence:
  MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWN
  ELKGTSKEDAMKAYINKVEELKKKYGI
• Function: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
• Tissue Specificity: Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
• KEGG Pathway: PPAR sig.ling pathway (hsa03320)
• Reactome Pathway: Mitochondrial Fatty Acid Beta-Oxidation (R-HSA-77289)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Angelman syndrome	DIS4QVXO	Definitive	Altered Expression	[1]
Parkinson disease	DISQVHKL	Definitive	Altered Expression	[2]
Achalasia	DISK845N	Strong	Biomarker	[3]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Genetic Variation	[5]
Anemia	DISTVL0C	Strong	Biomarker	[6]
Anxiety disorder	DISBI2BT	Strong	Genetic Variation	[7]
Autism spectrum disorder	DISXK8NV	Strong	Biomarker	[8]
Brain neoplasm	DISY3EKS	Strong	Altered Expression	[9]
Chronic fatigue syndrome	DIS34WJ5	Strong	Biomarker	[10]
Depression	DIS3XJ69	Strong	Biomarker	[7]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[4]
Language disorder	DISTLKP7	Strong	Biomarker	[8]
Leiomyoma	DISLDDFN	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[12]
Obesity	DIS47Y1K	Strong	Genetic Variation	[13]
Pervasive developmental disorder	DIS51975	Strong	Altered Expression	[8]
Prostate cancer	DISF190Y	Strong	Biomarker	[10]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[10]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[11]
Zellweger spectrum disorders	DISW52CE	Strong	Biomarker	[14]
Alcohol dependence	DIS4ZSCO	moderate	Genetic Variation	[15]
Anorexia nervosa cachexia	DISFO5RQ	moderate	Altered Expression	[16]
Anxiety	DISIJDBA	Limited	Genetic Variation	[7]
Carcinoma	DISH9F1N	Limited	Biomarker	[17]
Hepatic encephalopathy	DISEAKAN	Limited	Biomarker	[18]
High blood pressure	DISY2OHH	Limited	Biomarker	[19]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[20]
Undifferentiated carcinoma	DISIAZST	Limited	Biomarker	[17]

14 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Acyl-CoA-binding protein (DBI).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Acyl-CoA-binding protein (DBI).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Acyl-CoA-binding protein (DBI).	[23]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Acyl-CoA-binding protein (DBI).	[24]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Acyl-CoA-binding protein (DBI).	[25]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Acyl-CoA-binding protein (DBI).	[26]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Acyl-CoA-binding protein (DBI).	[27]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Acyl-CoA-binding protein (DBI).	[28]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Acyl-CoA-binding protein (DBI).	[29]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Acyl-CoA-binding protein (DBI).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Acyl-CoA-binding protein (DBI).	[31]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Acyl-CoA-binding protein (DBI).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Acyl-CoA-binding protein (DBI).	[33]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Acyl-CoA-binding protein (DBI).	[34]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Myristoyl-Coa	DMV7NGS	Investigative	Myristoyl-Coa affects the binding of Acyl-CoA-binding protein (DBI).	[35]

References

• [1] Peripheral markers of the gamma-aminobutyric acid (GABA)ergic system in Angelman's syndrome.J Child Neurol. 2003 Jan;18(1):21-5. doi: 10.1177/08830738030180010801.
• [2] Neuroprotective effects of the gliopeptide ODN in an in vivo model of Parkinson's disease.Cell Mol Life Sci. 2018 Jun;75(11):2075-2091. doi: 10.1007/s00018-017-2727-2. Epub 2017 Dec 20.
• [3] The assessment of the esophageal motility of children with esophageal disorders by the detailed observation of the pH-multichannel intraluminal impedance waveform and baseline impedance: screening test potential.Esophagus. 2019 Apr;16(2):133-140. doi: 10.1007/s10388-018-0640-x. Epub 2018 Aug 25.
• [4] Acyl-CoA-Binding Protein Fuels Gliomagenesis.Cell Metab. 2019 Aug 6;30(2):229-230. doi: 10.1016/j.cmet.2019.07.007.
• [5] RNA-Seq analysis of the parietal cortex in Alzheimer's disease reveals alternatively spliced isoforms related to lipid metabolism.Neurosci Lett. 2013 Mar 1;536:90-5. doi: 10.1016/j.neulet.2012.12.042. Epub 2013 Jan 7.
• [6] Dietary Balance Index-07 and the Risk of Anemia in Middle Aged and Elderly People in Southwest China: A Cross Sectional Study.Nutrients. 2018 Jan 31;10(2):162. doi: 10.3390/nu10020162.
• [7] Are there depression and anxiety genetic markers and mutations? A systematic review.J Affect Disord. 2014 Oct;168:387-98. doi: 10.1016/j.jad.2014.07.016. Epub 2014 Jul 22.
• [8] Phenotypic subgrouping and multi-omics analyses reveal reduced diazepam-binding inhibitor (DBI) protein levels in autism spectrum disorder with severe language impairment.PLoS One. 2019 Mar 28;14(3):e0214198. doi: 10.1371/journal.pone.0214198. eCollection 2019.
• [9] Increased expression of diazepam binding inhibitor in human brain tumors.Cell Growth Differ. 1995 Mar;6(3):309-14.
• [10] Differing leukocyte gene expression profiles associated with fatigue in patients with prostate cancer versus chronic fatigue syndrome.Psychoneuroendocrinology. 2013 Dec;38(12):2983-95. doi: 10.1016/j.psyneuen.2013.08.008. Epub 2013 Sep 6.
• [11] Expression of the energy substrate transporters in uterine fibroids.Prostaglandins Other Lipid Mediat. 2016 Mar;123:9-15. doi: 10.1016/j.prostaglandins.2016.02.002. Epub 2016 Feb 27.
• [12] Acyl-CoA-Binding Protein Drives Glioblastoma Tumorigenesis by Sustaining Fatty Acid Oxidation.Cell Metab. 2019 Aug 6;30(2):274-289.e5. doi: 10.1016/j.cmet.2019.04.004. Epub 2019 May 2.
• [13] The gliotransmitter ACBP controls feeding and energy homeostasis via the melanocortin system.J Clin Invest. 2019 Apr 2;129(6):2417-2430. doi: 10.1172/JCI123454.
• [14] Pathogenesis of peroxisomal deficiency disorders (Zellweger syndrome) may be mediated by misregulation of the GABAergic system via the diazepam binding inhibitor.BMC Pediatr. 2004 Mar 12;4:5. doi: 10.1186/1471-2431-4-5.
• [15] The relationship between alcoholism and DBI gene polymorphism in Japanese--genotyping of the +529A/T in DBI gene polymorphism based on PCR.Nihon Arukoru Yakubutsu Igakkai Zasshi. 2007 Dec;42(6):629-34.
• [16] Acyl-CoA-Binding Protein Is a Lipogenic Factor that Triggers Food Intake and Obesity.Cell Metab. 2019 Oct 1;30(4):754-767.e9. doi: 10.1016/j.cmet.2019.07.010. Epub 2019 Aug 15.
• [17] cDNA microarray profiling of rat mammary gland carcinomas induced by 2-amino-1-methyl-6-phenylimidazo[4,5-b]pyridine and 7,12-dimethylbenz[a]anthracene.Carcinogenesis. 2002 Oct;23(10):1561-8. doi: 10.1093/carcin/23.10.1561.
• [18] Role of DBI in brain and its posttranslational processing products in normal and abnormal behavior.Neuropharmacology. 1991 Dec;30(12B):1425-33. doi: 10.1016/s0028-3908(11)80012-2.
• [19] Diet quality is associated with reduced risk of hypertension among Inner Mongolia adults in northern China.Public Health Nutr. 2020 Jun;23(9):1543-1554. doi: 10.1017/S136898001900301X. Epub 2019 Nov 5.
• [20] Association of acyl-CoA-binding protein (ACBP) single nucleotide polymorphisms and type 2 diabetes in two German study populations.Mol Nutr Food Res. 2007 Feb;51(2):178-84. doi: 10.1002/mnfr.200600163.
• [21] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [22] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [23] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [24] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [25] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [26] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [27] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [28] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [29] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [30] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [31] Comparison of quantitation methods in proteomics to define relevant toxicological information on AhR activation of HepG2 cells by BaP. Toxicology. 2021 Jan 30;448:152652. doi: 10.1016/j.tox.2020.152652. Epub 2020 Dec 2.
• [32] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [33] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [34] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [35] High resolution crystal structures of unliganded and liganded human liver ACBP reveal a new mode of binding for the acyl-CoA ligand. Proteins. 2007 Jan 1;66(1):229-38. doi: 10.1002/prot.21124.