Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBHAG6A)

DOT Name Glycophorin-E (GYPE)
Gene Name GYPE
Related Disease
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive ( )
Abdominal aortic aneurysm ( )
Acute erythroid leukemia ( )
Acute lymphocytic leukaemia ( )
Advanced cancer ( )
Aplastic anemia ( )
Ataxia-telangiectasia ( )
Beta-thalassemia major ( )
Breast cancer ( )
Breast carcinoma ( )
Bronchitis ( )
Chronic obstructive pulmonary disease ( )
Cockayne syndrome ( )
Cystic fibrosis ( )
Depression ( )
Developmental and epileptic encephalopathy, 36 ( )
Fanconi anemia complementation group A ( )
Fanconi's anemia ( )
G6PD deficiency ( )
Glycogen storage disease I ( )
Graves disease ( )
Hemoglobinopathy ( )
Hepatitis B virus infection ( )
Hereditary spherocytosis ( )
High blood pressure ( )
leukaemia ( )
Lung cancer ( )
Lung carcinoma ( )
Malaria ( )
Malignant hyperthermia of anesthesia ( )
Melnick-Needles syndrome ( )
Myelodysplastic syndrome ( )
Neoplasm ( )
Paroxysmal nocturnal haemoglobinuria ( )
Polycythemia vera ( )
Pulmonary disease ( )
Seasonal allergic rhinitis ( )
Typhoid fever ( )
Bloom syndrome ( )
Bone development disease ( )
Osteochondrodysplasia ( )
Skeletal dysplasia ( )
Acute myelogenous leukaemia ( )
Leukemia ( )
Neuroblastoma ( )
Rett syndrome ( )
UniProt ID
GLPE_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIF
EVMLVVVGMIILISYCIR
Function This protein is a minor sialoglycoprotein in human erythrocyte membranes.
Tissue Specificity Erythrocytes.

Molecular Interaction Atlas (MIA) of This DOT

46 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Blast phase chronic myelogenous leukemia, BCR-ABL1 positive DIS3KLUX Definitive Biomarker [1]
Abdominal aortic aneurysm DISD06OF Strong Biomarker [2]
Acute erythroid leukemia DISZFC1O Strong Biomarker [3]
Acute lymphocytic leukaemia DISPX75S Strong Genetic Variation [4]
Advanced cancer DISAT1Z9 Strong Genetic Variation [5]
Aplastic anemia DISJRSC0 Strong Genetic Variation [6]
Ataxia-telangiectasia DISP3EVR Strong Genetic Variation [7]
Beta-thalassemia major DISW06BV Strong Biomarker [8]
Breast cancer DIS7DPX1 Strong Biomarker [9]
Breast carcinoma DIS2UE88 Strong Biomarker [9]
Bronchitis DISBM6EQ Strong Genetic Variation [10]
Chronic obstructive pulmonary disease DISQCIRF Strong Genetic Variation [11]
Cockayne syndrome DISW6GL2 Strong Biomarker [12]
Cystic fibrosis DIS2OK1Q Strong Genetic Variation [13]
Depression DIS3XJ69 Strong Biomarker [14]
Developmental and epileptic encephalopathy, 36 DISG4MY5 Strong Biomarker [15]
Fanconi anemia complementation group A DIS8PZLI Strong Genetic Variation [16]
Fanconi's anemia DISGW6Q8 Strong Genetic Variation [16]
G6PD deficiency DISYF1GO Strong Biomarker [17]
Glycogen storage disease I DISY4Q9T Strong Genetic Variation [18]
Graves disease DISU4KOQ Strong Biomarker [19]
Hemoglobinopathy DISCT4GX Strong Genetic Variation [20]
Hepatitis B virus infection DISLQ2XY Strong Biomarker [21]
Hereditary spherocytosis DISQYJP5 Strong Genetic Variation [22]
High blood pressure DISY2OHH Strong Genetic Variation [23]
leukaemia DISS7D1V Strong Genetic Variation [24]
Lung cancer DISCM4YA Strong Biomarker [11]
Lung carcinoma DISTR26C Strong Biomarker [11]
Malaria DISQ9Y50 Strong Biomarker [25]
Malignant hyperthermia of anesthesia DISYC9XI Strong Genetic Variation [26]
Melnick-Needles syndrome DIS0KTGM Strong Biomarker [27]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [28]
Neoplasm DISZKGEW Strong Biomarker [29]
Paroxysmal nocturnal haemoglobinuria DISBHMYH Strong Genetic Variation [6]
Polycythemia vera DISB5FPO Strong Biomarker [30]
Pulmonary disease DIS6060I Strong Genetic Variation [31]
Seasonal allergic rhinitis DIS58KQX Strong Biomarker [32]
Typhoid fever DISP3NHR Strong Biomarker [33]
Bloom syndrome DISKXQ7J moderate Genetic Variation [34]
Bone development disease DISVKAZS moderate Genetic Variation [35]
Osteochondrodysplasia DIS9SPWW moderate Genetic Variation [35]
Skeletal dysplasia DIS5Z8U6 moderate Genetic Variation [35]
Acute myelogenous leukaemia DISCSPTN Limited Biomarker [36]
Leukemia DISNAKFL Limited Genetic Variation [4]
Neuroblastoma DISVZBI4 Limited Biomarker [37]
Rett syndrome DISGG5UV Limited Genetic Variation [38]
------------------------------------------------------------------------------------
⏷ Show the Full List of 46 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Glycophorin-E (GYPE). [39]
Progesterone DMUY35B Approved Progesterone increases the expression of Glycophorin-E (GYPE). [40]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Glycophorin-E (GYPE). [41]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Glycophorin-E (GYPE). [42]
------------------------------------------------------------------------------------

References

1 Erythroid blast crisis in chronic myelogenous leukemia.Blood. 1983 Sep;62(3):591-6.
2 Blood groups and HLA antigens in patients with abdominal aortic aneurysms.Hum Hered. 1984;34(1):9-13. doi: 10.1159/000153411.
3 DKC1 is a transcriptional target of GATA1 and drives upregulation of telomerase activity in normal human erythroblasts.Haematologica. 2020 Jun;105(6):1517-1526. doi: 10.3324/haematol.2018.215699. Epub 2019 Aug 14.
4 Glycophorin A mutations and risk of secondary leukaemia in patients treated for childhood acute lymphoblastic leukaemia.Br J Haematol. 1996 Apr;93(1):117-24. doi: 10.1046/j.1365-2141.1996.4621001.x.
5 Individual variation of somatic gene mutability in relation to cancer susceptibility: prospective study on erythrocyte glycophorin a gene mutations of atomic bomb survivors.Cancer Res. 2005 Jun 15;65(12):5462-9. doi: 10.1158/0008-5472.CAN-04-1188.
6 Increased frequency of somatic mutations at glycophorin A loci in patients with aplastic anaemia, myelodysplastic syndrome and paroxysmal nocturnal haemoglobinuria.Br J Haematol. 1997 Aug;98(2):384-91. doi: 10.1046/j.1365-2141.1997.2233037.x.
7 Diagnosis of ataxia telangiectasia with the glycophorin A somatic mutation assay.Genet Test. 1997-1998;1(4):261-7. doi: 10.1089/gte.1997.1.261.
8 Ineffective erythropoiesis in beta-thalassemia major is due to apoptosis at the polychromatophilic normoblast stage.Exp Hematol. 2000 Dec;28(12):1343-53. doi: 10.1016/s0301-472x(00)00555-5.
9 Breast cancer and the MNSs blood groups.Dis Markers. 1989 Oct-Dec;7(4):253-6.
10 Exposure to cold and draught, alcohol consumption, and the NS-phenotype are associated with chronic bronchitis: an epidemiological investigation of 3387 men aged 53-75 years: the Copenhagen Male Study.Occup Environ Med. 2001 Mar;58(3):160-4. doi: 10.1136/oem.58.3.160.
11 Chromosome 4q31 locus in COPD is also associated with lung cancer.Eur Respir J. 2010 Dec;36(6):1375-82. doi: 10.1183/09031936.00033310.
12 Somatic cell mutation frequency at the HPRT, T-cell antigen receptor and glycophorin A loci in Cockayne syndrome.Mutat Res. 1995 Jul;337(1):49-55. doi: 10.1016/0921-8777(95)00014-b.
13 Linkage studies between polymorphic markers on chromosome 4 and cystic fibrosis.Hum Genet. 1985;69(3):250-4. doi: 10.1007/BF00293035.
14 Insulin-like growth factor-I peptides act centrally to decrease depression-like behavior of mice treated intraperitoneally with lipopolysaccharide.J Neuroinflammation. 2011 Dec 21;8:179. doi: 10.1186/1742-2094-8-179.
15 Band 3 glycoprotein and glycophorin A from erythrocytes of children with congenital disorder of glycosylation type-Ia are underglycosylated.Proteomics. 2001 Feb;1(2):269-74. doi: 10.1002/1615-9861(200102)1:2<269::AID-PROT269>3.0.CO;2-8.
16 Frequencies of HPRT- lymphocytes and glycophorin A variants erythrocytes in Fanconi anemia patients, their parents and control donors.Mutat Res. 1993 Sep;289(1):115-26. doi: 10.1016/0027-5107(93)90137-5.
17 Blood groups and types, hemoglobin variants, and G-6-PD deficiency among Abu Dhabians in the United Arab Emirates.Am J Phys Anthropol. 1980 May;52(4):481-4. doi: 10.1002/ajpa.1330520404.
18 Long-term safety and efficacy of AAV gene therapy in the canine model of glycogen storage disease type Ia.J Inherit Metab Dis. 2018 Nov;41(6):977-984. doi: 10.1007/s10545-018-0199-7. Epub 2018 May 25.
19 Differentiation of autoimmune ophthalmopathy from Graves' hyperthyroidism by analysis of genetic markers.Clin Endocrinol (Oxf). 1988 Jun;28(6):601-10. doi: 10.1111/j.1365-2265.1988.tb03851.x.
20 DNA array analysis for red blood cell antigens facilitates the transfusion support with antigen-matched blood in patients with sickle cell disease.Vox Sang. 2009 Aug;97(2):147-52. doi: 10.1111/j.1423-0410.2009.01185.x. Epub 2009 Apr 8.
21 Genetic survey of an isolated community in Bali, Indonesia. I. Blood groups, serum proteins and hepatitis B serology.Hum Hered. 1982;32(1):52-61. doi: 10.1159/000153259.
22 Glycophorin A: Band 3 aid.Blood Cells Mol Dis. 2008 Jul-Aug;41(1):35-43. doi: 10.1016/j.bcmd.2008.01.001. Epub 2008 Mar 4.
23 Adducin in essential hypertension.FEBS Lett. 1998 Jun 23;430(1-2):41-4. doi: 10.1016/s0014-5793(98)00457-8.
24 Somatic mutations at T-cell antigen receptor and glycophorin A loci in pediatric leukemia patients following chemotherapy: comparison with HPRT locus mutation.Mutat Res. 1994 Sep;315(2):95-103. doi: 10.1016/0921-8777(94)90010-8.
25 An ImmunoPEGliposome for Targeted Antimalarial Combination Therapy at the Nanoscale.Pharmaceutics. 2019 Jul 16;11(7):341. doi: 10.3390/pharmaceutics11070341.
26 A linkage study of malignant hyperthermia (MH).Clin Genet. 1990 Mar;37(3):221-5. doi: 10.1111/j.1399-0004.1990.tb03506.x.
27 Frequency of Red Blood Cell Antigens According to Parent Ethnicity in Korea Using Molecular Typing.Ann Lab Med. 2018 Nov;38(6):599-603. doi: 10.3343/alm.2018.38.6.599.
28 Detection of hematopoietic maturation abnormalities by flow cytometry in myelodysplastic syndromes and its utility for the differential diagnosis with non-clonal disorders.Leuk Res. 2007 Feb;31(2):147-55. doi: 10.1016/j.leukres.2006.04.010. Epub 2006 Jun 5.
29 Aptamer-Modified Magnetic Nanosensitizer for In Vivo MR Imaging of HER2-Expressing Cancer.Nanoscale Res Lett. 2018 Sep 18;13(1):288. doi: 10.1186/s11671-018-2682-3.
30 Structural, antigenetic and transcriptional characteristics in peripheral blood CD34+ progenitor cells from polycythemia vera patients: evidence for delayed determination.Int J Oncol. 2003 Aug;23(2):437-43.
31 Analysis of erythrocyte glycophorin-A variants by flow cytometry in lung disease patients detects the effect of tobacco smoke.Anal Cell Pathol. 2000;21(1):35-40. doi: 10.1155/2000/512786.
32 Erythrocyte antigens as immunogenetic markers of respiratory atopic diseases in Georgians.J Investig Allergol Clin Immunol. 1995 Jan-Feb;5(1):35-9.
33 ABO, Rh, MNSs, sex and typhoid fever.Hum Hered. 1993 Sep-Oct;43(5):301-10. doi: 10.1159/000154148.
34 Evidence for increased in vivo mutation and somatic recombination in Bloom's syndrome.Proc Natl Acad Sci U S A. 1989 Jan;86(2):670-4. doi: 10.1073/pnas.86.2.670.
35 Omphalocele and multiple severe congenital anomalies associated with osteodysplasty (Melnick-Needles syndrome).Am J Med Genet. 1982 Dec;13(4):453-63. doi: 10.1002/ajmg.1320130416.
36 S-phase DNA content and aneuploidy of immunophenotypic defined subpopulations in acute myeloid leukemia determined by multi-parameter flow cytometry.Leuk Res. 1991;15(9):827-35. doi: 10.1016/0145-2126(91)90467-8.
37 (R)--Lipoyl-Gly-l-Pro-l-Glu dimethyl ester as dual acting agent for the treatment of Alzheimer's disease.Neuropeptides. 2017 Dec;66:52-58. doi: 10.1016/j.npep.2017.09.001. Epub 2017 Oct 2.
38 Mutant astrocytes differentiated from Rett syndrome patients-specific iPSCs have adverse effects on wild-type neurons.Hum Mol Genet. 2014 Jun 1;23(11):2968-80. doi: 10.1093/hmg/ddu008. Epub 2014 Jan 12.
39 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
40 Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
41 Cellular reactions to long-term volatile organic compound (VOC) exposures. Sci Rep. 2016 Dec 1;6:37842. doi: 10.1038/srep37842.
42 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.