Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBQFUZH)

• DOT Name: Transcription factor MafG (MAFG)
• Synonyms: V-maf musculoaponeurotic fibrosarcoma oncogene homolog G; hMAF
• Gene Name: MAFG
• Related Disease:
  Cholestasis
  Colorectal carcinoma
  Intrahepatic cholestasis
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Neoplasm
  Carcinoma of liver and intrahepatic biliary tract
  Cholangiocarcinoma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Liver cancer
• UniProt ID: MAFG_HUMAN
• PDB ID: 7X5E; 7X5F; 7X5G
• Pfam ID: PF03131
• Sequence:
  MTTPNKGNKALKVKREPGENGTSLTDEELVTMSVRELNQHLRGLSKEEIVQLKQRRRTLK
  NRGYAASCRVKRVTQKEELEKQKAELQQEVEKLASENASMKLELDALRSKYEALQTFART
  VARSPVAPARGPLAAGLGPLVPGKVAATSVITIVKSKTDARS
• Function: Since they lack a putative transactivation domain, the small Mafs behave as transcriptional repressors when they dimerize among themselves. However, they seem to serve as transcriptional activators by dimerizing with other (usually larger) basic-zipper proteins, such as NFE2, NFE2L1 and NFE2L2, and recruiting them to specific DNA-binding sites. Small Maf proteins heterodimerize with Fos and may act as competitive repressors of the NFE2L2 transcription factor. Transcription factor, component of erythroid-specific transcription factor NFE2L2. Activates globin gene expression when associated with NFE2L2. May be involved in signal transduction of extracellular H(+).
• Tissue Specificity: Highly expressed in skeletal muscle. Also expressed in heart and brain.
• Reactome Pathway:
  NFE2L2 regulates pentose phosphate pathway genes (R-HSA-9818028)
  Factors involved in megakaryocyte development and platelet production (R-HSA-983231)
  Nuclear events mediated by NFE2L2 (R-HSA-9759194)

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cholestasis	DISDJJWE	Strong	Altered Expression	[1]
Colorectal carcinoma	DIS5PYL0	Strong	Genetic Variation	[2]
Intrahepatic cholestasis	DISHITDZ	Strong	Biomarker	[3]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[4]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[5]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[5]
Neoplasm	DISZKGEW	Strong	Altered Expression	[1]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[1]
Cholangiocarcinoma	DIS71F6X	Limited	Altered Expression	[1]
Hepatitis B virus infection	DISLQ2XY	Limited	Altered Expression	[1]
Hepatocellular carcinoma	DIS0J828	Limited	Altered Expression	[1]
Liver cancer	DISDE4BI	Limited	Biomarker	[1]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Transcription factor MafG (MAFG).	[6]
Triclosan	DMZUR4N	Approved	Triclosan increases the methylation of Transcription factor MafG (MAFG).	[14]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Transcription factor MafG (MAFG).	[25]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Transcription factor MafG (MAFG).	[7]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Transcription factor MafG (MAFG).	[8]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Transcription factor MafG (MAFG).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Transcription factor MafG (MAFG).	[10]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transcription factor MafG (MAFG).	[11]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Transcription factor MafG (MAFG).	[12]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Transcription factor MafG (MAFG).	[13]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Transcription factor MafG (MAFG).	[15]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Transcription factor MafG (MAFG).	[13]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Transcription factor MafG (MAFG).	[16]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Transcription factor MafG (MAFG).	[17]
Sodium lauryl sulfate	DMLJ634	Approved	Sodium lauryl sulfate increases the expression of Transcription factor MafG (MAFG).	[18]
Fenofibrate	DMFKXDY	Approved	Fenofibrate increases the expression of Transcription factor MafG (MAFG).	[19]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Transcription factor MafG (MAFG).	[19]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Transcription factor MafG (MAFG).	[19]
Nefazodone	DM4ZS8M	Approved	Nefazodone increases the expression of Transcription factor MafG (MAFG).	[20]
Benzoic acid	DMKB9FI	Approved	Benzoic acid increases the expression of Transcription factor MafG (MAFG).	[18]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Transcription factor MafG (MAFG).	[21]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the expression of Transcription factor MafG (MAFG).	[22]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl decreases the expression of Transcription factor MafG (MAFG).	[22]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Transcription factor MafG (MAFG).	[23]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of Transcription factor MafG (MAFG).	[18]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Transcription factor MafG (MAFG).	[24]
Disulfiram	DMCL2OK	Phase 2 Trial	Disulfiram increases the expression of Transcription factor MafG (MAFG).	[18]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Transcription factor MafG (MAFG).	[26]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Transcription factor MafG (MAFG).	[27]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of Transcription factor MafG (MAFG).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Transcription factor MafG (MAFG).	[28]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Transcription factor MafG (MAFG).	[18]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Transcription factor MafG (MAFG).	[29]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Transcription factor MafG (MAFG).	[30]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate increases the expression of Transcription factor MafG (MAFG).	[31]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Transcription factor MafG (MAFG).	[32]
geraniol	DMS3CBD	Investigative	geraniol increases the expression of Transcription factor MafG (MAFG).	[33]
2-tert-butylbenzene-1,4-diol	DMNXI1E	Investigative	2-tert-butylbenzene-1,4-diol decreases the expression of Transcription factor MafG (MAFG).	[22]
methyl salicylate	DMKCG8H	Investigative	methyl salicylate increases the expression of Transcription factor MafG (MAFG).	[18]
2-Propanol, Isopropanol	DML5O0H	Investigative	2-Propanol, Isopropanol increases the expression of Transcription factor MafG (MAFG).	[18]

References

• [1] Mechanisms of MAFG Dysregulation in Cholestatic Liver Injury and Development of Liver Cancer.Gastroenterology. 2018 Aug;155(2):557-571.e14. doi: 10.1053/j.gastro.2018.04.032. Epub 2018 May 5.
• [2] The BRAF oncoprotein functions through the transcriptional repressor MAFG to mediate the CpG Island Methylator phenotype.Mol Cell. 2014 Sep 18;55(6):904-915. doi: 10.1016/j.molcel.2014.08.010. Epub 2014 Sep 11.
• [3] Induction of avian musculoaponeurotic fibrosarcoma proteins by toxic bile acid inhibits expression of glutathione synthetic enzymes and contributes to cholestatic liver injury in mice. Hepatology. 2010 Apr;51(4):1291-301. doi: 10.1002/hep.23471.
• [4] LncRNA MAFG-AS1 boosts the proliferation of lung adenocarcinoma cells via regulating miR-744-5p/MAFG axis.Eur J Pharmacol. 2019 Sep 15;859:172465. doi: 10.1016/j.ejphar.2019.172465. Epub 2019 Jun 15.
• [5] Genetic variation and antioxidant response gene expression in the bronchial airway epithelium of smokers at risk for lung cancer.PLoS One. 2010 Aug 3;5(8):e11934. doi: 10.1371/journal.pone.0011934.
• [6] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [7] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [8] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [9] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
• [12] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [13] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [14] Pregnancy exposure to synthetic phenols and placental DNA methylation - An epigenome-wide association study in male infants from the EDEN cohort. Environ Pollut. 2021 Dec 1;290:118024. doi: 10.1016/j.envpol.2021.118024. Epub 2021 Aug 21.
• [15] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [16] Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
• [17] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [18] Keratinocyte gene expression profiles discriminate sensitizing and irritating compounds. Toxicol Sci. 2010 Sep;117(1):81-9.
• [19] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [20] Robustness testing and optimization of an adverse outcome pathway on cholestatic liver injury. Arch Toxicol. 2020 Apr;94(4):1151-1172. doi: 10.1007/s00204-020-02691-9. Epub 2020 Mar 10.
• [21] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [22] Mapping the dynamics of Nrf2 antioxidant and NFB inflammatory responses by soft electrophilic chemicals in human liver cells defines the transition from adaptive to adverse responses. Toxicol In Vitro. 2022 Oct;84:105419. doi: 10.1016/j.tiv.2022.105419. Epub 2022 Jun 17.
• [23] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [24] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [25] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [26] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [27] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [28] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [29] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [30] Microphysiological system modeling of ochratoxin A-associated nephrotoxicity. Toxicology. 2020 Nov;444:152582. doi: 10.1016/j.tox.2020.152582. Epub 2020 Sep 6.
• [31] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [32] An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.
• [33] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.