Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBX6FM5)

• DOT Name: Protein PRRC2A (PRRC2A)
• Synonyms: HLA-B-associated transcript 2; Large proline-rich protein BAT2; Proline-rich and coiled-coil-containing protein 2A; Protein G2
• Gene Name: PRRC2A
• Related Disease:
  Classic Hodgkin lymphoma
  Allergic asthma
  Aural atresia, congenital
  Epstein barr virus infection
  Lymphoma, non-Hodgkin, familial
  Major depressive disorder
  Membranous glomerulonephritis
  Multiple sclerosis
  Myasthenia gravis
  Non-hodgkin lymphoma
  Rheumatoid arthritis
  Ulcerative colitis
  High blood pressure
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Stroke
  Malaria
  Non-insulin dependent diabetes
  Schizophrenia
• UniProt ID: PRC2A_HUMAN
• Pfam ID: PF07001
• Sequence:
  MSDRSGPTAKGKDGKKYSSLNLFDTYKGKSLEIQKPAVAPRHGLQSLGKVAIARRMPPPA
  NLPSLKAENKGNDPNVSLVPKDGTGWASKQEQSDPKSSDASTAQPPESQPLPASQTPASN
  QPKRPPAAPENTPLVPSGVKSWAQASVTHGAHGDGGRASSLLSRFSREEFPTLQAAGDQD
  KAAKERESAEQSSGPGPSLRPQNSTTWRDGGGRGPDELEGPDSKLHHGHDPRGGLQPSGP
  PQFPPYRGMMPPFMYPPYLPFPPPYGPQGPYRYPTPDGPSRFPRVAGPRGSGPPMRLVEP
  VGRPSILKEDNLKEFDQLDQENDDGWAGAHEEVDYTEKLKFSDEEDGRDSDEEGAEGHRD
  SQSASGEERPPEADGKKGNSPNSEPPTPKTAWAETSRPPETEPGPPAPKPPLPPPHRGPA
  GNWGPPGDYPDRGGPPCKPPAPEDEDEAWRQRRKQSSSEISLAVERARRRREEEERRMQE
  ERRAACAEKLKRLDEKFGAPDKRLKAEPAAPPAAPSTPAPPPAVPKELPAPPAPPPASAP
  TPETEPEEPAQAPPAQSTPTPGVAAAPTLVSGGGSTSSTSSGSFEASPVEPQLPSKEGPE
  PPEEVPPPTTPPVPKVEPKGDGIGPTRQPPSQGLGYPKYQKSLPPRFQRQQQEQLLKQQQ
  QHQWQQHQQGSAPPTPVPPSPPQPVTLGAVPAPQAPPPPPKALYPGALGRPPPMPPMNFD
  PRWMMIPPYVDPRLLQGRPPLDFYPPGVHPSGLVPRERSDSGGSSSEPFDRHAPAMLRER
  GTPPVDPKLAWVGDVFTATPAEPRPLTSPLRQAADEDDKGMRSETPPVPPPPPYLASYPG
  FPENGAPGPPISRFPLEEPGPRPLPWPPGSDEVAKIQTPPPKKEPPKEETAQLTGPEAGR
  KPARGVGSGGQGPPPPRRESRTETRWGPRPGSSRRGIPPEEPGAPPRRAGPIKKPPPPTK
  VEELPPKPLEQGDETPKPPKPDPLKITKGKLGGPKETPPNGNLSPAPRLRRDYSYERVGP
  TSCRGRGRGEYFARGRGFRGTYGGRGRGARSREFRSYREFRGDDGRGGGTGGPNHPPAPR
  GRTASETRSEGSEYEEIPKRRRQRGSETGSETHESDLAPSDKEAPTPKEGTLTQVPLAPP
  PPGAPPSPAPARFTARGGRVFTPRGVPSRRGRGGGRPPPQVCPGWSPPAKSLAPKKPPTG
  PLPPSKEPLKEKLIPGPLSPVARGGSNGGSNVGMEDGERPRRRRHGRAQQQDKPPRFRRL
  KQERENAARGSEGKPSLTLPASAPGPEEALTTVTVAPAPRRAAAKSPDLSNQNSDQANEE
  WETASESSDFTSERRGDKEAPPPVLLTPKAVGTPGGGGGGAVPGISAMSRGDLSQRAKDL
  SKRSFSSQRPGMERQNRRPGPGGKAGSSGSSSGGGGGGPGGRTGPGRGDKRSWPSPKNRS
  RPPEERPPGLPLPPPPPSSSAVFRLDQVIHSNPAGIQQALAQLSSRQGSVTAPGGHPRHK
  PGLPQAPQGPSPRPPTRYEPQRVNSGLSSDPHFEEPGPMVRGVGGTPRDSAGVSPFPPKR
  RERPPRKPELLQEESLPPPHSSGFLGSKPEGPGPQAESRDTGTEALTPHIWNRLHTATSR
  KSYRPSSMEPWMEPLSPFEDVAGTEMSQSDSGVDLSGDSQVSSGPCSQRSSPDGGLKGAA
  EGPPKRPGGSSPLNAVPCEGPPGSEPPRRPPPAPHDGDRKELPREQPLPPGPIGTERSQR
  TDRGTEPGPIRPSHRPGPPVQFGTSDKDSDLRLVVGDSLKAEKELTASVTEAIPVSRDWE
  LLPSAAASAEPQSKNLDSGHCVPEPSSSGQRLYPEVFYGSAGPSSSQISGGAMDSQLHPN
  SGGFRPGTPSLHPYRSQPLYLPPGPAPPSALLSGLALKGQFLDFSTMQATELGKLPAGGV
  LYPPPSFLYSPAFCPSPLPDTSLLQVRQDLPSPSDFYSTPLQPGGQSGFLPSGAPAQQML
  LPMVDSQLPVVNFGSLPPAPPPAPPPLSLLPVGPALQPPSLAVRPPPAPATRVLPSPARP
  FPASLGRAELHPVELKPFQDYQKLSSNLGGPGSSRTPPTGRSFSGLNSRLKATPSTYSGV
  FRTQRVDLYQQASPPDALRWIPKPWERTGPPPREGPSRRAEEPGSRGDKEPGLPPPR
• Function: May play a role in the regulation of pre-mRNA splicing.
• Tissue Specificity: Limited to cell-lines of leukemic origin.

Molecular Interaction Atlas (MIA) of This DOT

20 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Classic Hodgkin lymphoma	DISV1LU6	Definitive	Genetic Variation	[1]
Allergic asthma	DISHF0H3	Strong	Genetic Variation	[2]
Aural atresia, congenital	DISCP7UV	Strong	Biomarker	[3]
Epstein barr virus infection	DISOO0WT	Strong	Genetic Variation	[4]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Strong	Genetic Variation	[5]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[6]
Membranous glomerulonephritis	DISFSUKQ	Strong	Genetic Variation	[7]
Multiple sclerosis	DISB2WZI	Strong	Genetic Variation	[8]
Myasthenia gravis	DISELRCI	Strong	Genetic Variation	[9]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Genetic Variation	[5]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[10]
Ulcerative colitis	DIS8K27O	Strong	Genetic Variation	[11]
High blood pressure	DISY2OHH	moderate	Genetic Variation	[12]
Lung cancer	DISCM4YA	moderate	Genetic Variation	[13]
Lung carcinoma	DISTR26C	moderate	Genetic Variation	[13]
Lung neoplasm	DISVARNB	moderate	Biomarker	[13]
Stroke	DISX6UHX	moderate	Genetic Variation	[14]
Malaria	DISQ9Y50	Disputed	Genetic Variation	[15]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Genetic Variation	[16]
Schizophrenia	DISSRV2N	Limited	Biomarker	[17]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Sodium lauryl sulfate	DMLJ634	Approved	Protein PRRC2A (PRRC2A) affects the response to substance of Sodium lauryl sulfate.	[32]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Protein PRRC2A (PRRC2A).	[18]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein PRRC2A (PRRC2A).	[19]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Protein PRRC2A (PRRC2A).	[20]
Marinol	DM70IK5	Approved	Marinol increases the expression of Protein PRRC2A (PRRC2A).	[22]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Protein PRRC2A (PRRC2A).	[23]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein PRRC2A (PRRC2A).	[25]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Protein PRRC2A (PRRC2A).	[26]
APR-246	DMNFADH	Phase 2	APR-246 affects the expression of Protein PRRC2A (PRRC2A).	[27]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Protein PRRC2A (PRRC2A).	[30]
Rutin	DMEHRAJ	Investigative	Rutin increases the expression of Protein PRRC2A (PRRC2A).	[31]
CATECHIN	DMY38SB	Investigative	CATECHIN increases the expression of Protein PRRC2A (PRRC2A).	[31]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein PRRC2A (PRRC2A).	[21]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Protein PRRC2A (PRRC2A).	[24]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein PRRC2A (PRRC2A).	[28]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Protein PRRC2A (PRRC2A).	[29]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Protein PRRC2A (PRRC2A).	[24]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Protein PRRC2A (PRRC2A).	[29]

References

• [1] Variation at 3p24.1 and 6q23.3 influences the risk of Hodgkin's lymphoma.Nat Commun. 2013;4:2549. doi: 10.1038/ncomms3549.
• [2] Haplotype analysis of a 100 kb region spanning TNF-LTA identifies a polymorphism in the LTA promoter region that is associated with atopic asthma susceptibility in Japan.Clin Exp Allergy. 2005 Jun;35(6):790-6. doi: 10.1111/j.1365-2222.2005.02265.x.
• [3] Human lymphocyte antigen B-associated transcript 2, 3, and 5 polymorphisms and haplotypes are associated with susceptibility of Kawasaki disease and coronary artery aneurysm.J Clin Lab Anal. 2010;24(4):262-8. doi: 10.1002/jcla.20409.
• [4] A genome-wide integrative genomic study localizes genetic factors influencing antibodies against Epstein-Barr virus nuclear antigen 1 (EBNA-1).PLoS Genet. 2013;9(1):e1003147. doi: 10.1371/journal.pgen.1003147. Epub 2013 Jan 10.
• [5] PRRC2A and BCL2L11 gene variants influence risk of non-Hodgkin lymphoma: results from the InterLymph consortium.Blood. 2012 Nov 29;120(23):4645-8. doi: 10.1182/blood-2012-05-427989. Epub 2012 Oct 9.
• [6] Genome-wide association study of depression phenotypes in UK Biobank identifies variants in excitatory synaptic pathways.Nat Commun. 2018 Apr 16;9(1):1470. doi: 10.1038/s41467-018-03819-3.
• [7] Risk HLA-DQA1 and PLA(2)R1 alleles in idiopathic membranous nephropathy.N Engl J Med. 2011 Feb 17;364(7):616-26. doi: 10.1056/NEJMoa1009742.
• [8] Risk alleles for multiple sclerosis identified by a genomewide study.N Engl J Med. 2007 Aug 30;357(9):851-62. doi: 10.1056/NEJMoa073493. Epub 2007 Jul 29.
• [9] Risk for myasthenia gravis maps to a (151) ProAla change in TNIP1 and to human leukocyte antigen-B*08.Ann Neurol. 2012 Dec;72(6):927-35. doi: 10.1002/ana.23691. Epub 2012 Oct 10.
• [10] A genome-wide association study suggests contrasting associations in ACPA-positive versus ACPA-negative rheumatoid arthritis.Ann Rheum Dis. 2011 Feb;70(2):259-65. doi: 10.1136/ard.2009.126821. Epub 2010 Dec 14.
• [11] Genome-wide association scan in north Indians reveals three novel HLA-independent risk loci for ulcerative colitis.Gut. 2015 Apr;64(4):571-9. doi: 10.1136/gutjnl-2013-306625. Epub 2014 May 16.
• [12] Genetic variations in MOV10 and CACNB2 are associated with hypertension in a Chinese Han population.Genet Mol Res. 2013 Dec 4;12(4):6220-7. doi: 10.4238/2013.December.4.9.
• [13] Low-frequency coding variants at 6p21.33 and 20q11.21 are associated with lung cancer risk in Chinese populations.Am J Hum Genet. 2015 May 7;96(5):832-40. doi: 10.1016/j.ajhg.2015.03.009. Epub 2015 Apr 30.
• [14] Gene variants associated with ischemic stroke: the cardiovascular health study.Stroke. 2009 Feb;40(2):363-8. doi: 10.1161/STROKEAHA.108.521328. Epub 2008 Nov 20.
• [15] A genetic association study in the Gambia using tagging polymorphisms in the major histocompatibility complex class III region implicates a HLA-B associated transcript 2 polymorphism in severe malaria susceptibility.Hum Genet. 2009 Feb;125(1):105-9. doi: 10.1007/s00439-008-0597-2. Epub 2008 Nov 28.
• [16] Obesity-related genomic loci are associated with type 2 diabetes in a Han Chinese population.PLoS One. 2014 Aug 5;9(8):e104486. doi: 10.1371/journal.pone.0104486. eCollection 2014.
• [17] The Weighting is the Hardest Part: On the Behavior of the Likelihood Ratio Test and the Score Test Under a Data-Driven Weighting Scheme in Sequenced Samples.Twin Res Hum Genet. 2017 Apr;20(2):108-118. doi: 10.1017/thg.2017.7. Epub 2017 Feb 27.
• [18] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [19] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [20] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [21] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [22] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [23] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [24] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [25] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [26] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [27] Mutant p53 reactivation by PRIMA-1MET induces multiple signaling pathways converging on apoptosis. Oncogene. 2010 Mar 4;29(9):1329-38. doi: 10.1038/onc.2009.425. Epub 2009 Nov 30.
• [28] Effect of aflatoxin B(1), benzo[a]pyrene, and methapyrilene on transcriptomic and epigenetic alterations in human liver HepaRG cells. Food Chem Toxicol. 2018 Nov;121:214-223. doi: 10.1016/j.fct.2018.08.034. Epub 2018 Aug 26.
• [29] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [30] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [31] Epicatechin and a cocoa polyphenolic extract modulate gene expression in human Caco-2 cells. J Nutr. 2004 Oct;134(10):2509-16.
• [32] Association of MHC region SNPs with irritant susceptibility in healthcare workers. J Immunotoxicol. 2016 Sep;13(5):738-44. doi: 10.3109/1547691X.2016.1173135. Epub 2016 Jun 3.