Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH4S7WB)

DOT Name Heat shock 70 kDa protein 6 (HSPA6)
Synonyms Heat shock 70 kDa protein B'
Gene Name HSPA6
Related Disease
Neoplasm ( )
Behcet disease ( )
Crohn disease ( )
Hepatocellular carcinoma ( )
Juvenile idiopathic arthritis ( )
Prostate cancer ( )
Prostate carcinoma ( )
Vascular disease ( )
Advanced cancer ( )
UniProt ID
HSP76_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3FE1
Pfam ID
PF00012
Sequence
MQAPRELAVGIDLGTTYSCVGVFQQGRVEILANDQGNRTTPSYVAFTDTERLVGDAAKSQ
AALNPHNTVFDAKRLIGRKFADTTVQSDMKHWPFRVVSEGGKPKVRVCYRGEDKTFYPEE
ISSMVLSKMKETAEAYLGQPVKHAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTA
AAIAYGLDRRGAGERNVLIFDLGGGTFDVSVLSIDAGVFEVKATAGDTHLGGEDFDNRLV
NHFMEEFRRKHGKDLSGNKRALRRLRTACERAKRTLSSSTQATLEIDSLFEGVDFYTSIT
RARFEELCSDLFRSTLEPVEKALRDAKLDKAQIHDVVLVGGSTRIPKVQKLLQDFFNGKE
LNKSINPDEAVAYGAAVQAAVLMGDKCEKVQDLLLLDVAPLSLGLETAGGVMTTLIQRNA
TIPTKQTQTFTTYSDNQPGVFIQVYEGERAMTKDNNLLGRFELSGIPPAPRGVPQIEVTF
DIDANGILSVTATDRSTGKANKITITNDKGRLSKEEVERMVHEAEQYKAEDEAQRDRVAA
KNSLEAHVFHVKGSLQEESLRDKIPEEDRRKMQDKCREVLAWLEHNQLAEKEEYEHQKRE
LEQICRPIFSRLYGGPGVPGGSSCGTQARQGDPSTGPIIEEVD
Function
Molecular chaperone implicated in a wide variety of cellular processes, including protection of the proteome from stress, folding and transport of newly synthesized polypeptides, activation of proteolysis of misfolded proteins and the formation and dissociation of protein complexes. Plays a pivotal role in the protein quality control system, ensuring the correct folding of proteins, the re-folding of misfolded proteins and controlling the targeting of proteins for subsequent degradation. This is achieved through cycles of ATP binding, ATP hydrolysis and ADP release, mediated by co-chaperones. The affinity for polypeptides is regulated by its nucleotide bound state. In the ATP-bound form, it has a low affinity for substrate proteins. However, upon hydrolysis of the ATP to ADP, it undergoes a conformational change that increases its affinity for substrate proteins. It goes through repeated cycles of ATP hydrolysis and nucleotide exchange, which permits cycles of substrate binding and release.
KEGG Pathway
Spliceosome (hsa03040 )
MAPK sig.ling pathway (hsa04010 )
Protein processing in endoplasmic reticulum (hsa04141 )
Endocytosis (hsa04144 )
Longevity regulating pathway - multiple species (hsa04213 )
Antigen processing and presentation (hsa04612 )
Estrogen sig.ling pathway (hsa04915 )
Prion disease (hsa05020 )
Legionellosis (hsa05134 )
Toxoplasmosis (hsa05145 )
Measles (hsa05162 )
Lipid and atherosclerosis (hsa05417 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Regulation of HSF1-mediated heat shock response (R-HSA-3371453 )

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Neoplasm DISZKGEW Definitive Altered Expression [1]
Behcet disease DISSYMBS Strong Altered Expression [2]
Crohn disease DIS2C5Q8 Strong Altered Expression [2]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [3]
Juvenile idiopathic arthritis DISQZGBV Strong Biomarker [4]
Prostate cancer DISF190Y Strong Genetic Variation [5]
Prostate carcinoma DISMJPLE Strong Genetic Variation [5]
Vascular disease DISVS67S Strong Altered Expression [6]
Advanced cancer DISAT1Z9 Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Heat shock 70 kDa protein 6 (HSPA6). [8]
TAK-243 DM4GKV2 Phase 1 TAK-243 increases the sumoylation of Heat shock 70 kDa protein 6 (HSPA6). [36]
------------------------------------------------------------------------------------
47 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [9]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [10]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [11]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [12]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [13]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Heat shock 70 kDa protein 6 (HSPA6). [14]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Heat shock 70 kDa protein 6 (HSPA6). [15]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Heat shock 70 kDa protein 6 (HSPA6). [16]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [17]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [18]
Decitabine DMQL8XJ Approved Decitabine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [19]
Marinol DM70IK5 Approved Marinol decreases the expression of Heat shock 70 kDa protein 6 (HSPA6). [20]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [21]
Menadione DMSJDTY Approved Menadione increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [18]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [22]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [23]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [24]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [25]
Ethanol DMDRQZU Approved Ethanol increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [26]
Cytarabine DMZD5QR Approved Cytarabine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [19]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [27]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [19]
Sertraline DM0FB1J Approved Sertraline increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [28]
Dopamine DMPGUCF Approved Dopamine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [29]
Dihydroxyacetone DMM1LG2 Approved Dihydroxyacetone increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [30]
Penicillamine DM40EF6 Approved Penicillamine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [31]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [32]
DNCB DMDTVYC Phase 2 DNCB increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [33]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [34]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [35]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [37]
Eugenol DM7US1H Patented Eugenol increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [27]
Celastrol DMWQIJX Preclinical Celastrol increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Heat shock 70 kDa protein 6 (HSPA6). [14]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [39]
Milchsaure DM462BT Investigative Milchsaure increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [27]
chloropicrin DMSGBQA Investigative chloropicrin increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [40]
Deguelin DMXT7WG Investigative Deguelin increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [41]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [42]
Glyphosate DM0AFY7 Investigative Glyphosate increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [43]
Nickel chloride DMI12Y8 Investigative Nickel chloride increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [12]
Phencyclidine DMQBEYX Investigative Phencyclidine increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [44]
QUERCITRIN DM1DH96 Investigative QUERCITRIN affects the expression of Heat shock 70 kDa protein 6 (HSPA6). [45]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [27]
crotylaldehyde DMTWRQI Investigative crotylaldehyde increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [46]
1,6-hexamethylene diisocyanate DMLB3RT Investigative 1,6-hexamethylene diisocyanate affects the expression of Heat shock 70 kDa protein 6 (HSPA6). [47]
NSC-1771 DMNXDGQ Investigative NSC-1771 increases the expression of Heat shock 70 kDa protein 6 (HSPA6). [27]
------------------------------------------------------------------------------------
⏷ Show the Full List of 47 Drug(s)

References

1 Induced transgene expression for the treatment of solid tumors by hematopoietic stem cell-based gene therapy.Cancer Gene Ther. 2012 May;19(5):352-7. doi: 10.1038/cgt.2012.8. Epub 2012 Mar 9.
2 Heat shock protein family A member 6 combined with clinical characteristics for the differential diagnosis of intestinal Behet's disease.J Dig Dis. 2018 Jun;19(6):350-358. doi: 10.1111/1751-2980.12613.
3 Upregulation of heat shock proteins (HSPA12A, HSP90B1, HSPA4, HSPA5 and HSPA6) in tumour tissues is associated with poor outcomes from HBV-related early-stage hepatocellular carcinoma.Int J Med Sci. 2015 Feb 15;12(3):256-63. doi: 10.7150/ijms.10735. eCollection 2015.
4 Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
5 Mutation detection in the human HSP7OB' gene by denaturing high-performance liquid chromatography.Cell Stress Chaperones. 2000 Nov;5(5):415-24. doi: 10.1379/1466-1268(2000)005<0415:mdithh>2.0.co;2.
6 HSP70 is associated with endothelial activation in placental vascular diseases.Mol Med. 2008 Sep-Oct;14(9-10):561-6. doi: 10.2119/2008-00009.Liu.
7 Small-molecule binding sites to explore protein-protein interactions in the cancer proteome.Mol Biosyst. 2016 Oct 20;12(10):3067-87. doi: 10.1039/c6mb00231e. Epub 2016 Jul 25.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
10 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
11 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
12 Evidence that HSP70 gene expression may be useful for assessing the cytocompatibility of dental biomaterials. Dent Mater J. 2004 Jun;23(2):184-9. doi: 10.4012/dmj.23.184.
13 The thioxotriazole copper(II) complex A0 induces endoplasmic reticulum stress and paraptotic death in human cancer cells. J Biol Chem. 2009 Sep 4;284(36):24306-19.
14 Gene expression profiling reveals novel regulation by bisphenol-A in estrogen receptor-alpha-positive human cells. Environ Res. 2006 Jan;100(1):86-92.
15 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
16 Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
17 Arsenic trioxide induces Hsp70 expression via reactive oxygen species and JNK pathway in MDA231 cells. Life Sci. 2005 Oct 14;77(22):2783-93. doi: 10.1016/j.lfs.2005.04.024.
18 Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
19 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
20 Gene expression changes in human small airway epithelial cells exposed to Delta9-tetrahydrocannabinol. Toxicol Lett. 2005 Aug 14;158(2):95-107.
21 Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
22 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
23 Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
24 Proteasome inhibitor PS-341 induces apoptosis through induction of endoplasmic reticulum stress-reactive oxygen species in head and neck squamous cell carcinoma cells. Mol Cell Biol. 2004 Nov;24(22):9695-704. doi: 10.1128/MCB.24.22.9695-9704.2004.
25 Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
26 Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
27 Development of a new in vitro skin sensitization assay (Epidermal Sensitization Assay; EpiSensA) using reconstructed human epidermis. Toxicol In Vitro. 2013 Dec;27(8):2213-24. doi: 10.1016/j.tiv.2013.08.007. Epub 2013 Aug 30.
28 Sertraline induces endoplasmic reticulum stress in hepatic cells. Toxicology. 2014 Aug 1;322:78-88. doi: 10.1016/j.tox.2014.05.007. Epub 2014 May 24.
29 Mitochondrial proteomics investigation of a cellular model of impaired dopamine homeostasis, an early step in Parkinson's disease pathogenesis. Mol Biosyst. 2014 Jun;10(6):1332-44.
30 The sunless tanning agent dihydroxyacetone induces stress response gene expression and signaling in cultured human keratinocytes and reconstructed epidermis. Redox Biol. 2020 Sep;36:101594. doi: 10.1016/j.redox.2020.101594. Epub 2020 May 29.
31 D-Penicillamine targets metastatic melanoma cells with induction of the unfolded protein response (UPR) and Noxa (PMAIP1)-dependent mitochondrial apoptosis. Apoptosis. 2012 Oct;17(10):1079-94.
32 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
33 MIP-1beta, a novel biomarker for in vitro sensitization test using human monocytic cell line. Toxicol In Vitro. 2006 Aug;20(5):736-42.
34 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
35 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
36 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
37 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
38 The quinone methide aurin is a heat shock response inducer that causes proteotoxic stress and Noxa-dependent apoptosis in malignant melanoma cells. J Biol Chem. 2015 Jan 16;290(3):1623-38.
39 Identification of gene markers for formaldehyde exposure in humans. Environ Health Perspect. 2007 Oct;115(10):1460-6. doi: 10.1289/ehp.10180.
40 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
41 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
42 Linking site-specific loss of histone acetylation to repression of gene expression by the mycotoxin ochratoxin A. Arch Toxicol. 2018 Feb;92(2):995-1014.
43 Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
44 Differential response of Mono Mac 6, BEAS-2B, and Jurkat cells to indoor dust. Environ Health Perspect. 2007 Sep;115(9):1325-32.
45 Molecular mechanisms of quercitrin-induced apoptosis in non-small cell lung cancer. Arch Med Res. 2014 Aug;45(6):445-54.
46 Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
47 Gene profiles of a human alveolar epithelial cell line after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis. Toxicol Lett. 2009 Feb 25;185(1):16-22. doi: 10.1016/j.toxlet.2008.11.017. Epub 2008 Dec 6.