Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJCXNJG)

• DOT Name: Protein S100-P (S100P)
• Synonyms: Migration-inducing gene 9 protein; MIG9; Protein S100-E; S100 calcium-binding protein P
• Gene Name: S100P
• Related Disease:
  Adenocarcinoma
  Lung adenocarcinoma
  Ovarian neoplasm
  Pancreatic tumour
  Polycystic ovarian syndrome
  Prostate neoplasm
  Nasopharyngeal carcinoma
  Osteoporosis
• UniProt ID: S100P_HUMAN
• PDB ID: 1J55; 1OZO; 2MJW; 7NMI
• Pfam ID: PF01023
• Sequence:
  MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKD
  LDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLK
• Function: May function as calcium sensor and contribute to cellular calcium signaling. In a calcium-dependent manner, functions by interacting with other proteins, such as EZR and PPP5C, and indirectly plays a role in physiological processes like the formation of microvilli in epithelial cells. May stimulate cell proliferation in an autocrine manner via activation of the receptor for activated glycation end products (RAGE).
• Tissue Specificity: Detected in all of the tissues except brain, testis and small intestine, expression level is higher in placenta, heart, lung, skeletal muscle, spleen and leukocyte. Up-regulated in various pancreatic ductal adenocarcinomas and pancreatic intraepithelial neoplasias.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adenocarcinoma	DIS3IHTY	Strong	Biomarker	[1]
Lung adenocarcinoma	DISD51WR	Strong	Genetic Variation	[2]
Ovarian neoplasm	DISEAFTY	Strong	Altered Expression	[3]
Pancreatic tumour	DIS3U0LK	Strong	Altered Expression	[4]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[5]
Prostate neoplasm	DISHDKGQ	Strong	Altered Expression	[6]
Nasopharyngeal carcinoma	DISAOTQ0	Limited	Genetic Variation	[7]
Osteoporosis	DISF2JE0	Limited	Genetic Variation	[8]

This DOT Affected the Drug Response of 5 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Methotrexate	DM2TEOL	Approved	Protein S100-P (S100P) affects the response to substance of Methotrexate.	[44]
Etoposide	DMNH3PG	Approved	Protein S100-P (S100P) increases the response to substance of Etoposide.	[45]
Mitoxantrone	DMM39BF	Approved	Protein S100-P (S100P) affects the response to substance of Mitoxantrone.	[44]
Capecitabine	DMTS85L	Approved	Protein S100-P (S100P) increases the response to substance of Capecitabine.	[46]
Epirubicin	DMPDW6T	Approved	Protein S100-P (S100P) increases the response to substance of Epirubicin.	[45]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein S100-P (S100P).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the methylation of Protein S100-P (S100P).	[16]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein S100-P (S100P).	[37]

37 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein S100-P (S100P).	[10]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Protein S100-P (S100P).	[11]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Protein S100-P (S100P).	[12]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Protein S100-P (S100P).	[13]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein S100-P (S100P).	[14]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein S100-P (S100P).	[15]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein S100-P (S100P).	[17]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Protein S100-P (S100P).	[18]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein S100-P (S100P).	[19]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Protein S100-P (S100P).	[19]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Protein S100-P (S100P).	[20]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein S100-P (S100P).	[21]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of Protein S100-P (S100P).	[22]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Protein S100-P (S100P).	[23]
Menadione	DMSJDTY	Approved	Menadione increases the expression of Protein S100-P (S100P).	[18]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Protein S100-P (S100P).	[24]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Protein S100-P (S100P).	[25]
Hydroquinone	DM6AVR4	Approved	Hydroquinone increases the expression of Protein S100-P (S100P).	[26]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Protein S100-P (S100P).	[20]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Protein S100-P (S100P).	[27]
Azacitidine	DMTA5OE	Approved	Azacitidine increases the expression of Protein S100-P (S100P).	[20]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide decreases the expression of Protein S100-P (S100P).	[28]
Bicalutamide	DMZMSPF	Approved	Bicalutamide increases the expression of Protein S100-P (S100P).	[29]
Estrone	DM5T6US	Approved	Estrone increases the expression of Protein S100-P (S100P).	[30]
Adenosine triphosphate	DM79F6G	Approved	Adenosine triphosphate increases the expression of Protein S100-P (S100P).	[31]
Gamolenic acid	DMQN30Z	Approved	Gamolenic acid increases the expression of Protein S100-P (S100P).	[32]
Promegestone	DMK4S8I	Approved	Promegestone increases the expression of Protein S100-P (S100P).	[33]
Mechlorethamine	DM0CVXA	Approved	Mechlorethamine increases the expression of Protein S100-P (S100P).	[34]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Protein S100-P (S100P).	[35]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Protein S100-P (S100P).	[36]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Protein S100-P (S100P).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Protein S100-P (S100P).	[39]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A increases the expression of Protein S100-P (S100P).	[40]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Protein S100-P (S100P).	[41]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos increases the expression of Protein S100-P (S100P).	[42]
NSC-1771	DMNXDGQ	Investigative	NSC-1771 increases the expression of Protein S100-P (S100P).	[42]
N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE	DM2D4KY	Investigative	N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE increases the expression of Protein S100-P (S100P).	[43]

References

• [1] Diagnostic utility of S100P and von Hippel-Lindau gene product (pVHL) in pancreatic adenocarcinoma-with implication of their roles in early tumorigenesis.Am J Surg Pathol. 2008 Jan;32(1):78-91. doi: 10.1097/PAS.0b013e31815701d1.
• [2] Identification of genes associated with matrix metalloproteinases in invasive lung adenocarcinoma.Oncol Lett. 2018 Jul;16(1):123-130. doi: 10.3892/ol.2018.8683. Epub 2018 May 10.
• [3] Unfavourable prognostic significance of S100P expression in ovarian cancers.Histopathology. 2007 Jul;51(1):125-8. doi: 10.1111/j.1365-2559.2007.02714.x. Epub 2007 May 31.
• [4] The role of S100P in the invasion of pancreatic cancer cells is mediated through cytoskeletal changes and regulation of cathepsin D.Cancer Res. 2007 Sep 15;67(18):8633-42. doi: 10.1158/0008-5472.CAN-07-0545.
• [5] Progesterone resistance in PCOS endometrium: a microarray analysis in clomiphene citrate-treated and artificial menstrual cycles.J Clin Endocrinol Metab. 2011 Jun;96(6):1737-46. doi: 10.1210/jc.2010-2600. Epub 2011 Mar 16.
• [6] Functional evidence implicating S100P in prostate cancer progression.Int J Cancer. 2008 Jul 15;123(2):330-339. doi: 10.1002/ijc.23447.
• [7] S100P is associated with proliferation and migration in nasopharyngeal carcinoma.Oncol Lett. 2017 Jul;14(1):525-532. doi: 10.3892/ol.2017.6198. Epub 2017 May 17.
• [8] Screening of differentially expressed genes in male idiopathic osteoporosis via RNA sequencing.Mol Med Rep. 2018 Jul;18(1):67-76. doi: 10.3892/mmr.2018.8985. Epub 2018 May 7.
• [9] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [10] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [11] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [12] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [13] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [14] Enhanced S100 calcium-binding protein P expression sensitizes human bladder cancer cells to cisplatin. BJU Int. 2011 Apr;107(7):1148-53. doi: 10.1111/j.1464-410X.2010.09535.x. Epub 2010 Aug 19.
• [15] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [16] Differential DNA methylation profile of key genes in malignant prostate epithelial cells transformed by inorganic arsenic or cadmium. Toxicol Appl Pharmacol. 2015 Aug 1;286(3):159-67.
• [17] Integrated assessment by multiple gene expression analysis of quercetin bioactivity on anticancer-related mechanisms in colon cancer cells in vitro. Eur J Nutr. 2005 Mar;44(3):143-56. doi: 10.1007/s00394-004-0503-1. Epub 2004 Apr 30.
• [18] Gene expression after treatment with hydrogen peroxide, menadione, or t-butyl hydroperoxide in breast cancer cells. Cancer Res. 2002 Nov 1;62(21):6246-54.
• [19] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [20] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [21] Zoledronate dysregulates fatty acid metabolism in renal tubular epithelial cells to induce nephrotoxicity. Arch Toxicol. 2018 Jan;92(1):469-485.
• [22] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [23] Progestins regulate genes that can elicit both proliferative and antiproliferative effects in breast cancer cells. Oncol Rep. 2008 Jun;19(6):1627-34.
• [24] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [25] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [26] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [27] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [28] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [29] Microarray analysis of bicalutamide action on telomerase activity, p53 pathway and viability of prostate carcinoma cell lines. J Pharm Pharmacol. 2005 Jan;57(1):83-92.
• [30] Using a customized DNA microarray for expression profiling of the estrogen-responsive genes to evaluate estrogen activity among natural estrogens and industrial chemicals. Environ Health Perspect. 2004 May;112(7):773-81. doi: 10.1289/ehp.6753.
• [31] Extracellular ATP drives breast cancer cell migration and metastasis via S100A4 production by cancer cells and fibroblasts. Cancer Lett. 2018 Aug 28;430:1-10. doi: 10.1016/j.canlet.2018.04.043. Epub 2018 May 5.
• [32] Antineoplastic effects of gamma linolenic Acid on hepatocellular carcinoma cell lines. J Clin Biochem Nutr. 2010 Jul;47(1):81-90.
• [33] Short-chain fatty acids enhance nuclear receptor activity through mitogen-activated protein kinase activation and histone deacetylase inhibition. Proc Natl Acad Sci U S A. 2004 May 4;101(18):7199-204.
• [34] S100P is selectively upregulated in tumor cell lines challenged with DNA cross-linking agents. Leuk Res. 2005 Oct;29(10):1181-90. doi: 10.1016/j.leukres.2005.03.012.
• [35] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [36] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [37] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [38] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [39] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [40] Inhibition of CXCL12-mediated chemotaxis of Jurkat cells by direct immunotoxicants. Arch Toxicol. 2016 Jul;90(7):1685-94. doi: 10.1007/s00204-015-1585-7. Epub 2015 Aug 28.
• [41] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.
• [42] RNA-protein correlation of liver toxicity markers in HepaRG cells. EXCLI J. 2020 Jan 17;19:135-153. doi: 10.17179/excli2019-2005. eCollection 2020.
• [43] Immediate up-regulation of the calcium-binding protein S100P and its involvement in the cytokinin-induced differentiation of human myeloid leukemia cells. Biochim Biophys Acta. 2005 Sep 10;1745(2):156-65.
• [44] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [45] S100P contributes to chemosensitivity of human ovarian cancer cell line OVCAR3. Oncol Rep. 2008 Aug;20(2):325-32.
• [46] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.