Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTJRJEXL)

• DOT Name: Kinesin-like protein KIF15 (KIF15)
• Synonyms: Kinesin-like protein 2; hKLP2; Kinesin-like protein 7; Serologically defined breast cancer antigen NY-BR-62
• Gene Name: KIF15
• Related Disease:
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Advanced cancer
  Anaplastic astrocytoma
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Endometrial carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  IgA nephropathy
  Melanoma
  Pancreatic cancer
  Triple negative breast cancer
  Uveal Melanoma
  Bipolar disorder
  Bladder cancer
  Braddock-carey syndrome 2
  Neoplasm
  Urinary bladder cancer
  Urinary bladder neoplasm
• UniProt ID: KIF15_HUMAN
• PDB ID: 4BN2; 6ZPH; 6ZPI; 7RYP
• Pfam ID: PF15908 ; PF00225
• Sequence:
  MAPGCKTELRSVTNGQSNQPSNEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLR
  LHSNPEPKTFTFDHVADVDTTQESVFATVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMM
  GPSESDNFSHNLRGVIPRSFEYLFSLIDREKEKAGAGKSFLCKCSFIEIYNEQIYDLLDS
  ASAGLYLREHIKKGVFVVGAVEQVVTSAAEAYQVLSGGWRNRRVASTSMNRESSRSHAVF
  TITIESMEKSNEIVNIRTSLLNLVDLAGSERQKDTHAEGMRLKEAGNINRSLSCLGQVIT
  ALVDVGNGKQRHVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGETLSTLNFAQRA
  KLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLAELASGQTPPESFLTRDKKKTNYMEYFQE
  AMLFFKKSEQEKKSLIEKVTQLEDLTLKKEKFIQSNKMIVKFREDQIIRLEKLHKESRGG
  FLPEEQDRLLSELRNEIQTLREQIEHHPRVAKYAMENHSLREENRRLRLLEPVKRAQEMD
  AQTIAKLEKAFSEISGMEKSDKNQQGFSPKAQKEPCLFANTEKLKAQLLQIQTELNNSKQ
  EYEEFKELTRKRQLELESELQSLQKANLNLENLLEATKACKRQEVSQLNKIHAETLKIIT
  TPTKAYQLHSRPVPKLSPEMGSFGSLYTQNSSILDNDILNEPVPPEMNEQAFEAISEELR
  TVQEQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQMQELFSSERIDWTKQQEELLSQLN
  VLEKQLQETQTKNDFLKSEVHDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHM
  HVQLQLDNLRLENEKLLESKACLQDSYDNLQEIMKFEIDQLSRNLQNFKKENETLKSDLN
  NLMELLEAEKERNNKLSLQFEEDKENSSKEILKVLEAVRQEKQKETAKCEQQMAKVQKLE
  ESLLATEKVISSLEKSRDSDKKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYN
  SALVDREESRVLIKKQEVDILDLKETLRLRILSEDIERDMLCEDLAHATEQLNMLTEASK
  KHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQLEHVMDSAAEDPQ
  SPKTPPHFQTHLAKLLETQEQEIEDGRASKTSLEHLVTKLNEDREVKNAEILRMKEQLRE
  MENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQNHPDNQQLKNEQEESIKERLAKSKIV
  EEMLKMKADLEEVQSALYNKEMECLRMTDEVERTQTLESKAFQEKEQLRSKLEEMYEERE
  RTSQEMEMLRKQVECLAEENGKLVGHQNLHQKIQYVVRLKKENVRLAEETEKLRAENVFL
  KEKKRSES
• Function: Plus-end directed kinesin-like motor enzyme involved in mitotic spindle assembly.
• Tissue Specificity: Expressed in testis, colon, thymus and in breast cancer.
• KEGG Pathway: Motor proteins (hsa04814)
• Reactome Pathway:
  COPI-dependent Golgi-to-ER retrograde traffic (R-HSA-6811434)
  Kinesins (R-HSA-983189)
  MHC class II antigen presentation (R-HSA-2132295)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung adenocarcinoma	DISD51WR	Definitive	Biomarker	[1]
Lung cancer	DISCM4YA	Definitive	Biomarker	[1]
Lung carcinoma	DISTR26C	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Anaplastic astrocytoma	DISSBE0K	Strong	Biomarker	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[5]
Endometrial carcinoma	DISXR5CY	Strong	Biomarker	[6]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[7]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
IgA nephropathy	DISZ8MTK	Strong	Biomarker	[8]
Melanoma	DIS1RRCY	Strong	Biomarker	[9]
Pancreatic cancer	DISJC981	Strong	Biomarker	[10]
Triple negative breast cancer	DISAMG6N	Strong	Altered Expression	[11]
Uveal Melanoma	DISA7ZGL	Strong	Biomarker	[9]
Bipolar disorder	DISAM7J2	Limited	Genetic Variation	[12]
Bladder cancer	DISUHNM0	Limited	Biomarker	[13]
Braddock-carey syndrome 2	DIS6S2DU	Limited	Unknown	[14]
Neoplasm	DISZKGEW	Limited	Biomarker	[9]
Urinary bladder cancer	DISDV4T7	Limited	Biomarker	[13]
Urinary bladder neoplasm	DIS7HACE	Limited	Biomarker	[13]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Kinesin-like protein KIF15 (KIF15) affects the response to substance of Doxorubicin.	[43]
Vinblastine	DM5TVS3	Approved	Kinesin-like protein KIF15 (KIF15) affects the response to substance of Vinblastine.	[43]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Kinesin-like protein KIF15 (KIF15).	[15]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Kinesin-like protein KIF15 (KIF15).	[23]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the phosphorylation of Kinesin-like protein KIF15 (KIF15).	[37]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Kinesin-like protein KIF15 (KIF15).	[37]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Kinesin-like protein KIF15 (KIF15).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Kinesin-like protein KIF15 (KIF15).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Kinesin-like protein KIF15 (KIF15).	[18]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Kinesin-like protein KIF15 (KIF15).	[19]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Kinesin-like protein KIF15 (KIF15).	[20]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Kinesin-like protein KIF15 (KIF15).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Kinesin-like protein KIF15 (KIF15).	[22]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Kinesin-like protein KIF15 (KIF15).	[24]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Kinesin-like protein KIF15 (KIF15).	[25]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Kinesin-like protein KIF15 (KIF15).	[26]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Kinesin-like protein KIF15 (KIF15).	[26]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Kinesin-like protein KIF15 (KIF15).	[27]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Kinesin-like protein KIF15 (KIF15).	[28]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Kinesin-like protein KIF15 (KIF15).	[25]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Kinesin-like protein KIF15 (KIF15).	[29]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Kinesin-like protein KIF15 (KIF15).	[30]
Cytarabine	DMZD5QR	Approved	Cytarabine increases the expression of Kinesin-like protein KIF15 (KIF15).	[31]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Kinesin-like protein KIF15 (KIF15).	[32]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Kinesin-like protein KIF15 (KIF15).	[33]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Kinesin-like protein KIF15 (KIF15).	[34]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Kinesin-like protein KIF15 (KIF15).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Kinesin-like protein KIF15 (KIF15).	[16]
TAK-114	DMTXE19	Phase 1	TAK-114 decreases the expression of Kinesin-like protein KIF15 (KIF15).	[35]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Kinesin-like protein KIF15 (KIF15).	[36]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Kinesin-like protein KIF15 (KIF15).	[38]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Kinesin-like protein KIF15 (KIF15).	[39]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Kinesin-like protein KIF15 (KIF15).	[40]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Kinesin-like protein KIF15 (KIF15).	[41]
geraniol	DMS3CBD	Investigative	geraniol decreases the expression of Kinesin-like protein KIF15 (KIF15).	[42]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate increases the expression of Kinesin-like protein KIF15 (KIF15).	[35]

References

• [1] Increased KIF15 Expression Predicts a Poor Prognosis in Patients with Lung Adenocarcinoma.Cell Physiol Biochem. 2018;51(1):1-10. doi: 10.1159/000495155. Epub 2018 Nov 15.
• [2] Kinesin family member 15 promotes cancer stem cell phenotype and malignancy via reactive oxygen species imbalance in hepatocellular carcinoma.Cancer Lett. 2020 Jul 10;482:112-125. doi: 10.1016/j.canlet.2019.11.008. Epub 2019 Nov 13.
• [3] Expression of targeting protein for Xenopus kinesin-like protein 2 is associated with progression of human malignant astrocytoma.Brain Res. 2010 Sep 17;1352:200-7. doi: 10.1016/j.brainres.2010.06.060. Epub 2010 Jun 30.
• [4] Distinct Diagnostic and Prognostic Values of Kinesin Family Member Genes Expression in Patients with Breast Cancer.Med Sci Monit. 2018 Dec 29;24:9442-9464. doi: 10.12659/MSM.913401.
• [5] Effects of TPX2 gene on radiotherapy sensitization in breast cancer stem cells.Oncol Lett. 2017 Aug;14(2):1531-1535. doi: 10.3892/ol.2017.6277. Epub 2017 May 29.
• [6] MiR-29a-5p inhibits proliferation and invasion and induces apoptosis in endometrial carcinoma via targeting TPX2.Cell Cycle. 2018;17(10):1268-1278. doi: 10.1080/15384101.2018.1475829. Epub 2018 Jul 23.
• [7] Identification of Potential Biomarkers in Association With Progression and Prognosis in Epithelial Ovarian Cancer by Integrated Bioinformatics Analysis.Front Genet. 2019 Oct 24;10:1031. doi: 10.3389/fgene.2019.01031. eCollection 2019.
• [8] The molecular phenotype of endocapillary proliferation: novel therapeutic targets for IgA nephropathy.PLoS One. 2014 Aug 18;9(8):e103413. doi: 10.1371/journal.pone.0103413. eCollection 2014.
• [9] KIF15 plays a role in promoting the tumorigenicity of melanoma.Exp Eye Res. 2019 Aug;185:107598. doi: 10.1016/j.exer.2019.02.014. Epub 2019 Feb 21.
• [10] KIF15 promotes pancreatic cancer proliferation via the MEK-ERK signalling pathway.Br J Cancer. 2017 Jul 11;117(2):245-255. doi: 10.1038/bjc.2017.165. Epub 2017 Jun 8.
• [11] Knockdown of Kinase Family 15 Inhibits Cancer Cell Proliferation In vitro and its Clinical Relevance in Triple-Negative Breast Cancer.Curr Mol Med. 2019;19(2):147-155. doi: 10.2174/1566524019666190308122108.
• [12] Genome-wide association study identifies 30 loci associated with bipolar disorder.Nat Genet. 2019 May;51(5):793-803. doi: 10.1038/s41588-019-0397-8. Epub 2019 May 1.
• [13] KIF15 promotes bladder cancer proliferation via the MEK-ERK signaling pathway.Cancer Manag Res. 2019 Feb 26;11:1857-1868. doi: 10.2147/CMAR.S191681. eCollection 2019.
• [14] Loss-of-Function Mutations in KIF15 Underlying a Braddock-Carey Genocopy. Hum Mutat. 2017 May;38(5):507-510. doi: 10.1002/humu.23188. Epub 2017 Mar 10.
• [15] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [16] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [17] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [18] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [19] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [20] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [21] Convergent transcriptional profiles induced by endogenous estrogen and distinct xenoestrogens in breast cancer cells. Carcinogenesis. 2006 Aug;27(8):1567-78.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [24] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [25] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [26] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [27] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [28] Methotrexate modulates folate phenotype and inflammatory profile in EA.hy 926 cells. Eur J Pharmacol. 2014 Jun 5;732:60-7.
• [29] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [30] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [31] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [32] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [33] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] In silico, in vitro and in vivo studies: Dibutyl phthalate promotes prostate cancer cell proliferation by activating Forkhead Box M1 and remission after Natura- pretreatment. Toxicology. 2023 Apr;488:153465. doi: 10.1016/j.tox.2023.153465. Epub 2023 Feb 23.
• [36] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [37] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [38] The genome-wide expression profile of Scrophularia ningpoensis-treated thapsigargin-stimulated U-87MG cells. Neurotoxicology. 2009 May;30(3):368-76.
• [39] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [40] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [41] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [42] Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
• [43] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.