Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK4LT3K)

• DOT Name: Probable G-protein coupled receptor 162 (GPR162)
• Synonyms: Gene-rich cluster gene A protein
• Gene Name: GPR162
• Related Disease:
  Colorectal carcinoma
  Type-1/2 diabetes
  Advanced cancer
  Anaplastic astrocytoma
  Astrocytoma
  Coronary heart disease
  Fish eye disease
  Hepatocellular carcinoma
  Hyperalphalipoproteinemia
  Hyperlipidemia
  MHC class II deficiency
  Neoplasm
  Norum disease
  Prostate cancer
  Prostate carcinoma
  Pulmonary sarcoidosis
  Sarcoidosis
  Seasonal allergic rhinitis
  Tangier disease
  Tularemia
  Arteriosclerosis
  Atherosclerosis
  Giardiasis
  High blood pressure
  Coronary atherosclerosis
  Marfan syndrome
• UniProt ID: GP162_HUMAN
• Pfam ID: PF00001
• Sequence:
  MARGGAGAEEASLRSNALSWLACGLLALLANAWIILSISAKQQKHKPLELLLCFLAGTHI
  LMAAVPLTTFAVVQLRRQASSDYDWNESICKVFVSTYYTLALATCFTVASLSYHRMWMVR
  WPVNYRLSNAKKQALHAVMGIWMVSFILSTLPSIGWHNNGERYYARGCQFIVSKIGLGFG
  VCFSLLLLGGIVMGLVCVAITFYQTLWARPRRARQARRVGGGGGTKAGGPGALGTRPAFE
  VPAIVVEDARGKRRSSLDGSESAKTSLQVTNLVSAIVFLYDSLTGVPILVVSFFSLKSDS
  APPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYA
  EGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIF
  STPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLR
  QFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSL
  GSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL
• Function: Orphan receptor.

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Definitive	Biomarker	[1]
Type-1/2 diabetes	DISIUHAP	Definitive	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Anaplastic astrocytoma	DISSBE0K	Strong	Genetic Variation	[3]
Astrocytoma	DISL3V18	Strong	Biomarker	[3]
Coronary heart disease	DIS5OIP1	Strong	Biomarker	[4]
Fish eye disease	DISYTZNQ	Strong	Biomarker	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[6]
Hyperalphalipoproteinemia	DISPUX00	Strong	Genetic Variation	[7]
Hyperlipidemia	DIS61J3S	Strong	Biomarker	[8]
MHC class II deficiency	DISWMI0G	Strong	Biomarker	[9]
Neoplasm	DISZKGEW	Strong	Biomarker	[10]
Norum disease	DISSJE3M	Strong	Biomarker	[11]
Prostate cancer	DISF190Y	Strong	Biomarker	[12]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[12]
Pulmonary sarcoidosis	DIS1XQCN	Strong	Altered Expression	[13]
Sarcoidosis	DISE5B8Z	Strong	Genetic Variation	[14]
Seasonal allergic rhinitis	DIS58KQX	Strong	Biomarker	[15]
Tangier disease	DIS57P0M	Strong	Biomarker	[16]
Tularemia	DISF94A2	Strong	Genetic Variation	[17]
Arteriosclerosis	DISK5QGC	moderate	Altered Expression	[18]
Atherosclerosis	DISMN9J3	moderate	Altered Expression	[18]
Giardiasis	DISWUNWK	moderate	Genetic Variation	[19]
High blood pressure	DISY2OHH	moderate	Biomarker	[20]
Coronary atherosclerosis	DISKNDYU	Limited	Biomarker	[4]
Marfan syndrome	DISVEUWZ	Limited	Genetic Variation	[21]

5 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Probable G-protein coupled receptor 162 (GPR162).	[22]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Probable G-protein coupled receptor 162 (GPR162).	[23]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Probable G-protein coupled receptor 162 (GPR162).	[24]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Probable G-protein coupled receptor 162 (GPR162).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Probable G-protein coupled receptor 162 (GPR162).	[26]

References

• [1] Diabetes-associated angiotensin activation enhances liver metastasis of colon cancer.Clin Exp Metastasis. 2012 Dec;29(8):915-25. doi: 10.1007/s10585-012-9480-6. Epub 2012 May 3.
• [2] Significance of intranuclear angiotensin-II type 2 receptor in oral squamous cell carcinoma.Oncotarget. 2018 Nov 27;9(93):36561-36574. doi: 10.18632/oncotarget.26337. eCollection 2018 Nov 27.
• [3] IDH mutant diffuse and anaplastic astrocytomas have similar age at presentation and little difference in survival: a grading problem for WHO.Acta Neuropathol. 2015 Jun;129(6):867-73. doi: 10.1007/s00401-015-1438-8. Epub 2015 May 12.
• [4] Fibrates increase human apolipoprotein A-II expression through activation of the peroxisome proliferator-activated receptor.J Clin Invest. 1995 Aug;96(2):741-50. doi: 10.1172/JCI118118.
• [5] Markedly accelerated catabolism of apolipoprotein A-II (ApoA-II) and high density lipoproteins containing ApoA-II in classic lecithin: cholesterol acyltransferase deficiency and fish-eye disease.J Clin Invest. 1994 Jan;93(1):321-30. doi: 10.1172/JCI116962.
• [6] Extracellular processing of proapolipoprotein A-II in Hep G2 cell cultures is mediated by a 54-kDa protease immunologically related to cathepsin B.J Biol Chem. 1985 Nov 25;260(27):14824-31.
• [7] High density lipoproteins, reverse transport of cholesterol, and coronary artery disease. Insights from mutations.Circulation. 1993 Apr;87(4 Suppl):III28-34.
• [8] Intraindividual variations in lipoprotein (a) levels and factors related to these changes.J Atheroscler Thromb. 1996;2(2):96-106. doi: 10.5551/jat1994.2.96.
• [9] Correction of defective expression in MHC class II deficiency (bare lymphocyte syndrome) cells by retroviral transduction of CIITA.J Immunol. 1997 Aug 1;159(3):1086-95.
• [10] Expression of MAS1 in breast cancer.Cancer Sci. 2015 Sep;106(9):1240-8. doi: 10.1111/cas.12719. Epub 2015 Jul 20.
• [11] Characterization of subspecies of lipoprotein containing apolipoprotein A-I in heterozygotes for familial lecithin:cholesterol acyltransferase deficiency.Atherosclerosis. 1995 Apr 24;114(2):147-55. doi: 10.1016/0021-9150(94)05478-2.
• [12] Angiotensin II receptor blocker shows antiproliferative activity in prostate cancer cells: a possibility of tyrosine kinase inhibitor of growth factor.Mol Cancer Ther. 2003 Nov;2(11):1139-47.
• [13] Angiotensin II receptor on BALF macrophages from Japanese patients with active sarcoidosis.Sarcoidosis Vasc Diffuse Lung Dis. 1999 Mar;16(1):67-74.
• [14] Tumour necrosis factor-alpha promoter polymorphism in erythema nodosum.Acta Derm Venereol. 2001 Jan-Feb;81(1):18-21. doi: 10.1080/00015550116912.
• [15] Erythrocyte antigens as immunogenetic markers of respiratory atopic diseases in Georgians.J Investig Allergol Clin Immunol. 1995 Jan-Feb;5(1):35-9.
• [16] Plasma apolipoprotein concentrations in familial apolipoprotein A-I and A-II deficiency (Tangier disease).Metabolism. 1981 Aug;30(8):805-9. doi: 10.1016/0026-0495(81)90027-5.
• [17] Phylogenetic Analysis of Francisella tularensis Group A.II Isolates from 5 Patients with Tularemia, Arizona, USA, 2015-2017.Emerg Infect Dis. 2019 May;25(5):944-946. doi: 10.3201/eid2505.180363.
• [18] An experimental study on amelioration of dyslipidemia-induced atherosclesis by Clematichinenoside through regulating Peroxisome proliferator-activated receptor- mediated apolipoprotein A-I, A-II and C-III.Eur J Pharmacol. 2015 Aug 15;761:362-74. doi: 10.1016/j.ejphar.2015.04.015. Epub 2015 May 12.
• [19] Long-term monitoring of microsporidia, Cryptosporidium and Giardia infections in western Lowland Gorillas (Gorilla gorilla gorilla) at different stages of habituation in Dzanga Sangha Protected Areas, Central African Republic.PLoS One. 2013 Aug 7;8(8):e71840. doi: 10.1371/journal.pone.0071840. eCollection 2013.
• [20] Integration of multi-scale molecular modeling approaches with experiments for the in silico guided design and discovery of novel hERG-Neutral antihypertensive oxazalone and imidazolone derivatives and analysis of their potential restrictive effects on cell proliferation.Eur J Med Chem. 2018 Feb 10;145:273-290. doi: 10.1016/j.ejmech.2017.12.021. Epub 2017 Dec 11.
• [21] FBN1 mutation in Chinese patients with Marfan syndrome and its gene diagnosis using haplotype linkage analysis.Chin Med J (Engl). 2003 Jul;116(7):1043-6.
• [22] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [23] DNA methylation inhibits p53-mediated survivin repression. Oncogene. 2009 May 14;28(19):2046-50. doi: 10.1038/onc.2009.62. Epub 2009 Apr 13.
• [24] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [25] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [26] Comparison of transcriptome expression alterations by chronic exposure to low-dose bisphenol A in different subtypes of breast cancer cells. Toxicol Appl Pharmacol. 2019 Dec 15;385:114814. doi: 10.1016/j.taap.2019.114814. Epub 2019 Nov 9.