Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKGNZN5)

DOT Name DNA-binding protein inhibitor ID-1 (ID1)
Synonyms Class B basic helix-loop-helix protein 24; bHLHb24; Inhibitor of DNA binding 1; Inhibitor of differentiation 1
Gene Name ID1
UniProt ID
ID1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00010
Sequence
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
Function
Transcriptional regulator (lacking a basic DNA binding domain) which negatively regulates the basic helix-loop-helix (bHLH) transcription factors by forming heterodimers and inhibiting their DNA binding and transcriptional activity. Implicated in regulating a variety of cellular processes, including cellular growth, senescence, differentiation, apoptosis, angiogenesis, and neoplastic transformation. Inhibits skeletal muscle and cardiac myocyte differentiation. Regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-BMAL1 heterodimer.
KEGG Pathway
Rap1 sig.ling pathway (hsa04015 )
TGF-beta sig.ling pathway (hsa04350 )
Hippo sig.ling pathway (hsa04390 )
Sig.ling pathways regulating pluripotency of stem cells (hsa04550 )
Reactome Pathway
NGF-stimulated transcription (R-HSA-9031628 )
Oncogene Induced Senescence (R-HSA-2559585 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
57 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [1]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [9]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [11]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of DNA-binding protein inhibitor ID-1 (ID1). [12]
Decitabine DMQL8XJ Approved Decitabine increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [13]
Marinol DM70IK5 Approved Marinol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [14]
Selenium DM25CGV Approved Selenium increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [15]
Progesterone DMUY35B Approved Progesterone increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [16]
Menadione DMSJDTY Approved Menadione affects the expression of DNA-binding protein inhibitor ID-1 (ID1). [17]
Fluorouracil DMUM7HZ Approved Fluorouracil increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [18]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [19]
Folic acid DMEMBJC Approved Folic acid decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [20]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [21]
Cannabidiol DM0659E Approved Cannabidiol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [22]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [23]
Azacitidine DMTA5OE Approved Azacitidine increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [13]
Methamphetamine DMPM4SK Approved Methamphetamine decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [24]
Lindane DMB8CNL Approved Lindane decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [25]
Sodium phenylbutyrate DMXLBCQ Approved Sodium phenylbutyrate decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [26]
Bexarotene DMOBIKY Approved Bexarotene increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [27]
Pomalidomide DMTGBAX Approved Pomalidomide increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [28]
Pantothenic acid DM091H2 Approved Pantothenic acid increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [29]
Iloprost DMVPZBE Approved Iloprost increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [30]
Treprostinil DMTIQF3 Approved Treprostinil increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [30]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [31]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [32]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [33]
Napabucasin DMDZ6Q3 Phase 3 Napabucasin decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [34]
Genistein DM0JETC Phase 2/3 Genistein decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [32]
Gossypol DMJWE3I Phase 2 Gossypol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [35]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [25]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [36]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [37]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [38]
LG100268 DM41RK2 Discontinued in Phase 1 LG100268 increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [27]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [39]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [40]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [41]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [42]
chloropicrin DMSGBQA Investigative chloropicrin decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [43]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [44]
geraniol DMS3CBD Investigative geraniol increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [45]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [10]
Resorcinol DMM37C0 Investigative Resorcinol decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [22]
Butanoic acid DMTAJP7 Investigative Butanoic acid increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [46]
crotylaldehyde DMTWRQI Investigative crotylaldehyde decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [47]
Rapamycin Immunosuppressant Drug DM678IB Investigative Rapamycin Immunosuppressant Drug increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [48]
CH-223191 DMMJZYC Investigative CH-223191 increases the expression of DNA-binding protein inhibitor ID-1 (ID1). [49]
LY2109761 DMAWTG3 Investigative LY2109761 decreases the expression of DNA-binding protein inhibitor ID-1 (ID1). [50]
------------------------------------------------------------------------------------
⏷ Show the Full List of 57 Drug(s)

References

1 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
9 Study of As(2)O(3) regulating proliferation and apoptosis of Tca8113 cells by inhibiting the expression of Id-1. Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):1932-1937. doi: 10.1080/21691401.2019.1613419.
10 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
13 The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
14 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
15 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
16 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
17 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
18 Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
19 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
20 Folic acid supplementation dysregulates gene expression in lymphoblastoid cells--implications in nutrition. Biochem Biophys Res Commun. 2011 Sep 9;412(4):688-92. doi: 10.1016/j.bbrc.2011.08.027. Epub 2011 Aug 16.
21 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
22 Targeting multiple cannabinoid anti-tumour pathways with a resorcinol derivative leads to inhibition of advanced stages of breast cancer. Br J Pharmacol. 2014 Oct;171(19):4464-77. doi: 10.1111/bph.12803. Epub 2014 Sep 5.
23 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
24 Methamphetamine alters the normal progression by inducing cell cycle arrest in astrocytes. PLoS One. 2014 Oct 7;9(10):e109603.
25 Transcriptome-based functional classifiers for direct immunotoxicity. Arch Toxicol. 2014 Mar;88(3):673-89.
26 Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
27 Identification of biomarkers modulated by the rexinoid LGD1069 (bexarotene) in human breast cells using oligonucleotide arrays. Cancer Res. 2006 Dec 15;66(24):12009-18.
28 Immunomodulatory derivative of thalidomide (IMiD CC-4047) induces a shift in lineage commitment by suppressing erythropoiesis and promoting myelopoiesis. Blood. 2005 May 15;105(10):3833-40. doi: 10.1182/blood-2004-03-0828. Epub 2004 Aug 3.
29 Calcium pantothenate modulates gene expression in proliferating human dermal fibroblasts. Exp Dermatol. 2009 Nov;18(11):969-78. doi: 10.1111/j.1600-0625.2009.00884.x. Epub 2009 Apr 8.
30 Smad-dependent and smad-independent induction of id1 by prostacyclin analogues inhibits proliferation of pulmonary artery smooth muscle cells in vitro and in vivo. Circ Res. 2010 Jul 23;107(2):252-62. doi: 10.1161/CIRCRESAHA.109.209940. Epub 2010 Jun 3.
31 Non-redundant inhibitor of differentiation (Id) gene expression and function in human prostate epithelial cells. Prostate. 2006 Jun 15;66(9):921-35. doi: 10.1002/pros.20366.
32 The dietary compounds resveratrol and genistein induce activating transcription factor 3 while suppressing inhibitor of DNA binding/differentiation-1. J Med Food. 2011 Jun;14(6):584-93. doi: 10.1089/jmf.2010.0110. Epub 2011 May 9.
33 Curcumin suppresses growth of mesothelioma cells in vitro and in vivo, in part, by stimulating apoptosis. Mol Cell Biochem. 2011 Nov;357(1-2):83-94. doi: 10.1007/s11010-011-0878-2. Epub 2011 May 19.
34 Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
35 Combined gossypol and zoledronic acid treatment results in synergistic induction of cell death and regulates angiogenic molecules in ovarian cancer cells. Eur Cytokine Netw. 2009 Sep;20(3):121-30. doi: 10.1684/ecn.2009.0159.
36 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
37 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
38 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
39 Bisphenol A stimulates the epithelial mesenchymal transition of estrogen negative breast cancer cells via FOXA1 signals. Arch Biochem Biophys. 2015 Nov 1;585:10-16. doi: 10.1016/j.abb.2015.09.006. Epub 2015 Sep 9.
40 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
41 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
42 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
43 Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
44 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
45 Geraniol suppresses prostate cancer growth through down-regulation of E2F8. Cancer Med. 2016 Oct;5(10):2899-2908.
46 MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
47 Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.
48 Toxicogenomics-based identification of mechanisms for direct immunotoxicity. Toxicol Sci. 2013 Oct;135(2):328-46.
49 Adaptive changes in global gene expression profile of lung carcinoma A549 cells acutely exposed to distinct types of AhR ligands. Toxicol Lett. 2018 Aug;292:162-174.
50 In vitro and ex vivo anti-fibrotic effects of LY2109761, a small molecule inhibitor against TGF-. Toxicol Appl Pharmacol. 2018 Sep 15;355:127-137. doi: 10.1016/j.taap.2018.07.001. Epub 2018 Jul 3.