Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTNMQPFJ)

DOT Name	Proto-oncogene serine/threonine-protein kinase mos (MOS)
Synonyms	EC 2.7.11.1; Oocyte maturation factor mos; Proto-oncogene c-Mos
Gene Name	MOS
Related Disease	B-cell neoplasm ( ) Gastric neoplasm ( ) Acute lymphocytic leukaemia ( ) Advanced cancer ( ) Bladder cancer ( ) Breast neoplasm ( ) Carcinoma ( ) Chromosomal disorder ( ) Colorectal neoplasm ( ) Fibromyalgia ( ) Food allergy ( ) Gastric cancer ( ) Hepatocellular carcinoma ( ) Irritable bowel syndrome ( ) Lung cancer ( ) Lung carcinoma ( ) Lymphoproliferative syndrome ( ) Medullary thyroid gland carcinoma ( ) Melanoma ( ) Myeloid leukaemia ( ) Neuralgia ( ) Neuroblastoma ( ) Non-small-cell lung cancer ( ) Pheochromocytoma ( ) Psoriatic arthritis ( ) Rheumatoid arthritis ( ) Seminoma ( ) Stomach cancer ( ) Superficial epidermolytic ichthyosis ( ) Thyroid tumor ( ) Eating disorder ( ) Osteoarthritis ( ) Acute leukaemia ( ) Leukemia ( ) Lymphoma ( ) Lymphoma, non-Hodgkin, familial ( ) Non-hodgkin lymphoma ( ) Oocyte/zygote/embryo maturation arrest 20 ( ) Stroke ( )
UniProt ID	MOS_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
EC Number	2.7.11.1
Pfam ID	PF00069
Sequence	MPSPLALRPYLRSEFSPSVDARPCSSPSELPAKLLLGATLPRAPRLPRRLAWCSIDWEQV CLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRV VAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAGHPEGDAGEPHCRTGGQLSLGKCLK YSLDVVNGLLFLHSQSIVHLDLKPANILISEQDVCKISDFGCSEKLEDLLCFQTPSYPLG GTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLS AAVFEDSLPGQRLGDVIQRCWRPSAAQRPSARLLLVDLTSLKAELG
Function	Serine/threonine kinase involved in the regulation of MAPK signaling. Is an activator of the ERK1/2 signaling cascade playing an essential role in the stimulation of oocyte maturation.
Tissue Specificity	Highly expressed in oocytes. Lower expression is detected in early embryo.
KEGG Pathway	Oocyte meiosis (hsa04114 ) Regulation of actin cytoskeleton (hsa04810 ) Progesterone-mediated oocyte maturation (hsa04914 )

Molecular Interaction Atlas (MIA) of This DOT

39 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
B-cell neoplasm	DISVY326	Definitive	Biomarker	[1]
Gastric neoplasm	DISOKN4Y	Definitive	Altered Expression	[2]
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[4]
Bladder cancer	DISUHNM0	Strong	Biomarker	[5]
Breast neoplasm	DISNGJLM	Strong	Genetic Variation	[6]
Carcinoma	DISH9F1N	Strong	Genetic Variation	[7]
Chromosomal disorder	DISM5BB5	Strong	Genetic Variation	[8]
Colorectal neoplasm	DISR1UCN	Strong	Genetic Variation	[9]
Fibromyalgia	DISZJDS2	Strong	Genetic Variation	[10]
Food allergy	DISMQ1BP	Strong	Biomarker	[11]
Gastric cancer	DISXGOUK	Strong	Biomarker	[12]
Hepatocellular carcinoma	DIS0J828	Strong	Posttranslational Modification	[13]
Irritable bowel syndrome	DIS27206	Strong	Genetic Variation	[14]
Lung cancer	DISCM4YA	Strong	Biomarker	[15]
Lung carcinoma	DISTR26C	Strong	Biomarker	[15]
Lymphoproliferative syndrome	DISMVL8O	Strong	Genetic Variation	[9]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Biomarker	[16]
Melanoma	DIS1RRCY	Strong	Biomarker	[17]
Myeloid leukaemia	DISMN944	Strong	Genetic Variation	[18]
Neuralgia	DISWO58J	Strong	Biomarker	[19]
Neuroblastoma	DISVZBI4	Strong	Biomarker	[20]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[7]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[16]
Psoriatic arthritis	DISLWTG2	Strong	Genetic Variation	[21]
Rheumatoid arthritis	DISTSB4J	Strong	Genetic Variation	[22]
Seminoma	DIS3J8LJ	Strong	Altered Expression	[23]
Stomach cancer	DISKIJSX	Strong	Biomarker	[12]
Superficial epidermolytic ichthyosis	DISWX6O4	Strong	Genetic Variation	[14]
Thyroid tumor	DISLVKMD	Strong	Biomarker	[24]
Eating disorder	DISVGXN0	moderate	Genetic Variation	[25]
Osteoarthritis	DIS05URM	moderate	Genetic Variation	[26]
Acute leukaemia	DISDQFDI	Limited	Biomarker	[27]
Leukemia	DISNAKFL	Limited	Biomarker	[28]
Lymphoma	DISN6V4S	Limited	Biomarker	[29]
Lymphoma, non-Hodgkin, familial	DISCXYIZ	Limited	Biomarker	[30]
Non-hodgkin lymphoma	DISS2Y8A	Limited	Biomarker	[30]
Oocyte/zygote/embryo maturation arrest 20	DISIXQ6P	Limited	Unknown	[31]
Stroke	DISX6UHX	Limited	Biomarker	[32]
------------------------------------------------------------------------------------


⏷ Show the Full List of 39 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Proto-oncogene serine/threonine-protein kinase mos (MOS) increases the Apoptosis ADR of Paclitaxel.	[38]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[33]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[35]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[37]
------------------------------------------------------------------------------------

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate increases the expression of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[34]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[34]
Scriptaid	DM9JZ21	Preclinical	Scriptaid affects the expression of Proto-oncogene serine/threonine-protein kinase mos (MOS).	[36]
------------------------------------------------------------------------------------

References

1	Expression of cellular myc and mos genes in undifferentiated B cell lymphomas of Burkitt and non-Burkitt types.Proc Natl Acad Sci U S A. 1983 Apr;80(7):1947-50. doi: 10.1073/pnas.80.7.1947.
2	Risk Factors for Metachronous Gastric Neoplasms in Patients Who Underwent Endoscopic Resection of a Gastric Neoplasm.Gut Liver. 2016 Mar;10(2):228-36. doi: 10.5009/gnl14472.
3	The EcoRI RFLP of c-mos in patients with non-Hodgkin's lymphoma and acute lymphoblastic leukemia, compared to geriatric and non-geriatric controls.Int J Cancer. 1989 Jun 15;43(6):1034-6. doi: 10.1002/ijc.2910430613.
4	Bone marrow endothelium-targeted therapeutics for metastatic breast cancer.J Control Release. 2014 Aug 10;187:22-9. doi: 10.1016/j.jconrel.2014.04.057. Epub 2014 May 10.
5	Transforming genes in human tumors.J Cell Biochem. 1982;20(1):51-61. doi: 10.1002/jcb.240200106.
6	A single point mutation responsible for c-mos polymorphism in cancer patients.Oncogene. 1987 May;1(2):235-7.
7	Deregulated expression of c-mos in non-small cell lung carcinomas: relationship with p53 status, genomic instability, and tumor kinetics.Cancer Res. 2001 Jan 15;61(2):538-49.
8	Structural alterations of the c-mos locus in benign pleomorphic adenomas with chromosome abnormalities of 8q12.Oncogene. 1991 Jul;6(7):1105-8.
9	Proto-oncogene allelic variations in human squamous cell carcinomas of the larynx.Eur Arch Otorhinolaryngol. 1991;248(5):279-85. doi: 10.1007/BF00176755.
10	Understanding the different relationships between mood and sleep disorders in several groups of non-oncological patients with chronic pain.Curr Med Res Opin. 2018 Apr;34(4):669-676. doi: 10.1080/03007995.2017.1384372. Epub 2017 Oct 25.
11	Insight into the allergenicity of shrimp tropomyosin glycated by functional oligosaccharides containing advanced glycation end products.Food Chem. 2020 Jan 1;302:125348. doi: 10.1016/j.foodchem.2019.125348. Epub 2019 Aug 9.
12	Chemoprevention of gastric cancer by Helicobacter pylori eradication and its underlying mechanism.J Gastroenterol Hepatol. 2019 Aug;34(8):1287-1295. doi: 10.1111/jgh.14646. Epub 2019 Mar 27.
13	Hypomethylation of c-myc and epidermal growth factor receptor genes in human hepatocellular carcinoma and fetal liver.Jpn J Cancer Res. 1985 Dec;76(12):1136-40.
14	Transcutaneous electric nerve stimulation over acupoints for patients with diarrhea-predominant irritable bowel syndrome: Protocol for systematic review and meta-analysis.Medicine (Baltimore). 2018 Dec;97(51):e13267. doi: 10.1097/MD.0000000000013267.
15	Biomarkers in non-small cell lung cancer prevention.Eur J Cancer Prev. 2004 Oct;13(5):425-36. doi: 10.1097/00008469-200410000-00011.
16	Mutation analysis of the c-mos proto-oncogene and the endothelin-B receptor gene in medullary thyroid carcinoma and phaeochromocytoma.Br J Cancer. 1996 Aug;74(3):339-41. doi: 10.1038/bjc.1996.363.
17	Class II histocompatibility antigen expression in human melanocytes transformed by Harvey murine sarcoma virus (Ha-MSV) and Kirsten MSV retroviruses.J Exp Med. 1986 Nov 1;164(5):1710-22. doi: 10.1084/jem.164.5.1710.
18	Identification in several human myeloid leukemias or cell lines of a DNA rearrangement next to the c-mos 3'-end.FEBS Lett. 1985 Sep 9;189(1):97-101. doi: 10.1016/0014-5793(85)80850-4.
19	Mixed-methods development of a new patient-reported outcome instrument for chronic low back pain: part 1-the Patient Assessment for Low Back Pain - Symptoms (PAL-S).Pain. 2018 Jun;159(6):1045-1055. doi: 10.1097/j.pain.0000000000001187.
20	Detection of c-mos proto-oncogene expression in human cells.Oncogene. 1993 Jun;8(6):1685-91.
21	The relationship between clinical characteristics including presence of exposed lesions and health-related quality of life (HRQoL) in patients with psoriasis: analysis from the nationwide epidemiologic study for psoriasis in Korea (EPI-PSODE study).J Eur Acad Dermatol Venereol. 2018 Sep;32(9):1499-1506. doi: 10.1111/jdv.14865. Epub 2018 Mar 5.
22	Evaluation of pain intensity in people with rheumatoid arthritis using the MOS intensity scale.Med Clin (Barc). 2019 Aug 2;153(3):106-111. doi: 10.1016/j.medcli.2018.04.017. Epub 2018 May 25.
23	Differential expression of protooncogenes in human germ cell tumors of the testis.Cancer. 1994 Mar 15;73(6):1721-7. doi: 10.1002/1097-0142(19940315)73:6<1721::aid-cncr2820730628>3.0.co;2-w.
24	Abnormal expression of the MOS proto-oncogene in human thyroid medullary carcinoma.Cancer Lett. 1988 Dec 15;43(3):185-9. doi: 10.1016/0304-3835(88)90169-3.
25	Food addiction among Spanish-speaking Latino/as residing in the United States.Eat Behav. 2018 Aug;30:61-65. doi: 10.1016/j.eatbeh.2018.05.009. Epub 2018 May 24.
26	Quadriceps combined with hip abductor strengthening versus quadriceps strengthening in treating knee osteoarthritis: a study protocol for a randomized controlled trial.BMC Musculoskelet Disord. 2018 May 15;19(1):147. doi: 10.1186/s12891-018-2041-7.
27	Translocation of the MOS gene in a rare t(8;16) associated with acute myeloblastic leukemia and Down syndrome.Cancer Genet Cytogenet. 1989 Feb;37(2):221-7. doi: 10.1016/0165-4608(89)90052-6.
28	Localization of the human c-mos gene by in situ hybridization in two cases of acute nonlymphocytic leukemia type M2.Cancer Genet Cytogenet. 1987 Jan;24(1):137-41. doi: 10.1016/0165-4608(87)90090-2.
29	Chromosomal locations of human tissue plasminogen activator and urokinase genes.Science. 1985 Nov 8;230(4726):672-4. doi: 10.1126/science.3840278.
30	Expression of common fragile sites in untreated non-Hodgkin's lymphoma with aphidicolin and folate deficiency.Cancer Lett. 1994 Oct 28;86(1):111-7. doi: 10.1016/0304-3835(94)90187-2.
31	Biallelic mutations in MOS cause female infertility characterized by human early embryonic arrest and fragmentation. EMBO Mol Med. 2021 Dec 7;13(12):e14887. doi: 10.15252/emmm.202114887. Epub 2021 Nov 15.
32	Influence of Environmental Factors on Social Participation Post-Stroke.Behav Neurol. 2019 Jan 16;2019:2606039. doi: 10.1155/2019/2606039. eCollection 2019.
33	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
34	Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
35	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
36	Histone deacetylase inhibitor scriptaid induces cell cycle arrest and epigenetic change in colon cancer cells. Int J Oncol. 2008 Oct;33(4):767-76.
37	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
38	ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.