Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTT5JX1F)

• DOT Name: Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF)
• Synonyms: LPS-induced TNF-alpha factor; Small integral membrane protein of lysosome/late endosome; p53-induced gene 7 protein
• Gene Name: LITAF
• Related Disease:
  Acute leukaemia
  Advanced cancer
  Bipolar disorder
  Charcot-Marie-Tooth disease type 1
  Charcot-Marie-Tooth disease type 1C
  Chronic kidney disease
  Demyelinating polyneuropathy
  Glioma
  Hereditary neuropathy with liability to pressure palsies
  Metabolic disorder
  Neoplasm
  Nervous system disease
  Non-alcoholic fatty liver disease
  Non-alcoholic steatohepatitis
  Non-insulin dependent diabetes
  Obesity
  Pancreatic cancer
  Peripheral sensory neuropathies
  Prostate cancer
  Prostate carcinoma
  Restless legs syndrome
  Charcot marie tooth disease
  Crohn disease
  Inflammatory bowel disease
  Osteoarthritis
  Ulcerative colitis
  B-cell neoplasm
  Charcot-Marie-Tooth disease type 1A
  Peripheral neuropathy
  Prostate neoplasm
• UniProt ID: LITAF_HUMAN
• Pfam ID: PF10601
• Sequence:
  MSVPGPYQAATGPSSAPSAPPSYEETVAVNSYYPTPPAPMPGPTTGLVTGPDGKGMNPPS
  YYTQPAPIPNNNPITVQTVYVQHPITFLDRPIQMCCPSCNKMIVSQLSYNAGALTWLSCG
  SLCLLGCIAGCCFIPFCVDALQDVDHYCPNCRALLGTYKRL
• Function: Plays a role in endosomal protein trafficking and in targeting proteins for lysosomal degradation. Plays a role in targeting endocytosed EGFR and ERGG3 for lysosomal degradation, and thereby helps down-regulate downstream signaling cascades. Helps recruit the ESCRT complex components TSG101, HGS and STAM to cytoplasmic membranes. Probably plays a role in regulating protein degradation via its interaction with NEDD4. May also contribute to the regulation of gene expression in the nucleus. Binds DNA (in vitro) and may play a synergistic role with STAT6 in the nucleus in regulating the expression of various cytokines. May regulate the expression of numerous cytokines, such as TNF, CCL2, CCL5, CXCL1, IL1A and IL10.
• Tissue Specificity: Ubiquitously and abundantly expressed. Expressed predominantly in the placenta, peripheral blood leukocytes, lymph nodes and spleen.
• KEGG Pathway: Lysosome (hsa04142)

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute leukaemia	DISDQFDI	Strong	Altered Expression	[1]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[2]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[3]
Charcot-Marie-Tooth disease type 1	DIS56F9A	Strong	Biomarker	[4]
Charcot-Marie-Tooth disease type 1C	DISTREJ7	Strong	Autosomal dominant	[5]
Chronic kidney disease	DISW82R7	Strong	Biomarker	[6]
Demyelinating polyneuropathy	DIS7IO4W	Strong	Genetic Variation	[7]
Glioma	DIS5RPEH	Strong	Biomarker	[8]
Hereditary neuropathy with liability to pressure palsies	DISY0X1V	Strong	Genetic Variation	[9]
Metabolic disorder	DIS71G5H	Strong	Altered Expression	[10]
Neoplasm	DISZKGEW	Strong	Biomarker	[8]
Nervous system disease	DISJ7GGT	Strong	Biomarker	[11]
Non-alcoholic fatty liver disease	DISDG1NL	Strong	Biomarker	[12]
Non-alcoholic steatohepatitis	DIST4788	Strong	Biomarker	[12]
Non-insulin dependent diabetes	DISK1O5Z	Strong	Genetic Variation	[13]
Obesity	DIS47Y1K	Strong	Altered Expression	[10]
Pancreatic cancer	DISJC981	Strong	Biomarker	[8]
Peripheral sensory neuropathies	DISYWI6M	Strong	Biomarker	[14]
Prostate cancer	DISF190Y	Strong	Biomarker	[8]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[8]
Restless legs syndrome	DISNWY00	Strong	Biomarker	[15]
Charcot marie tooth disease	DIS3BT2L	Moderate	Autosomal dominant	[16]
Crohn disease	DIS2C5Q8	moderate	Genetic Variation	[17]
Inflammatory bowel disease	DISGN23E	moderate	Genetic Variation	[17]
Osteoarthritis	DIS05URM	moderate	Genetic Variation	[18]
Ulcerative colitis	DIS8K27O	moderate	Genetic Variation	[17]
B-cell neoplasm	DISVY326	Limited	Biomarker	[19]
Charcot-Marie-Tooth disease type 1A	DISSRZG7	Limited	Genetic Variation	[20]
Peripheral neuropathy	DIS7KN5G	Limited	Genetic Variation	[14]
Prostate neoplasm	DISHDKGQ	Limited	Biomarker	[21]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) affects the response to substance of Paclitaxel.	[47]
Mitomycin	DMH0ZJE	Approved	Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF) affects the response to substance of Mitomycin.	[47]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[22]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[39]

23 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[23]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[24]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[25]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[26]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[27]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[29]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[30]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[31]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[32]
Selenium	DM25CGV	Approved	Selenium increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[33]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[34]
Menthol	DMG2KW7	Approved	Menthol increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[35]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[36]
Mecamylamine	DMGQFYB	Approved	Mecamylamine decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[34]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[37]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[38]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[40]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[41]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[42]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[43]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[44]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[45]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID increases the expression of Lipopolysaccharide-induced tumor necrosis factor-alpha factor (LITAF).	[46]

References

• [1] Expression of pig7 gene in acute leukemia and its potential to modulate the chemosensitivity of leukemic cells.Leuk Res. 2009 Jan;33(1):28-38. doi: 10.1016/j.leukres.2008.06.034.
• [2] LITAF is a potential tumor suppressor in pancreatic cancer.Oncotarget. 2017 Dec 14;9(3):3131-3142. doi: 10.18632/oncotarget.23220. eCollection 2018 Jan 9.
• [3] Is a SIMPLe smartphone application capable of improving biological rhythms in bipolar disorder?.J Affect Disord. 2017 Dec 1;223:10-16. doi: 10.1016/j.jad.2017.07.028. Epub 2017 Jul 10.
• [4] A novel LITAF/SIMPLE mutation within a family with a demyelinating form of Charcot-Marie-Tooth disease.J Neurol Sci. 2014 Aug 15;343(1-2):183-6. doi: 10.1016/j.jns.2014.05.029. Epub 2014 May 22.
• [5] Mapping of Charcot-Marie-Tooth disease type 1C to chromosome 16p identifies a novel locus for demyelinating neuropathies. Am J Hum Genet. 2002 Jan;70(1):244-50. doi: 10.1086/337943. Epub 2001 Nov 16.
• [6] Creasensor: SIMPLE technology for creatinine detection in plasma.Anal Chim Acta. 2018 Feb 13;1000:191-198. doi: 10.1016/j.aca.2017.11.026. Epub 2017 Nov 22.
• [7] Hereditary motor and sensory neuropathy caused by a novel mutation in LITAF.Neuromuscul Disord. 2009 Oct;19(10):701-3. doi: 10.1016/j.nmd.2009.05.006. Epub 2009 Jun 21.
• [8] LITAF Enhances Radiosensitivity of Human Glioma Cells via the FoxO1 Pathway.Cell Mol Neurobiol. 2019 Aug;39(6):871-882. doi: 10.1007/s10571-019-00686-4. Epub 2019 May 16.
• [9] The LITAF/SIMPLE I92V sequence variant results in an earlier age of onset of CMT1A/HNPP diseases.Neurogenetics. 2015 Jan;16(1):27-32. doi: 10.1007/s10048-014-0426-9. Epub 2014 Oct 24.
• [10] Differential expression of mRNA isoforms in the skeletal muscle of pigs with distinct growth and fatness profiles.BMC Genomics. 2018 Feb 14;19(1):145. doi: 10.1186/s12864-018-4515-2.
• [11] Tryptophan to Glycine mutation in the position 116 leads to protein aggregation and decreases the stability of the LITAF protein.J Biomol Struct Dyn. 2015;33(8):1695-709. doi: 10.1080/07391102.2014.968211. Epub 2014 Oct 13.
• [12] LPS-induced TNF- factor mediates pro-inflammatory and pro-fibrogenic pattern in non-alcoholic fatty liver disease.Oncotarget. 2015 Dec 8;6(39):41434-52. doi: 10.18632/oncotarget.5163.
• [13] Design of a randomised controlled trial of the effects of empagliflozin on myocardial perfusion, function and metabolism in type 2 diabetes patients at high cardiovascular risk (the SIMPLE trial).BMJ Open. 2019 Nov 27;9(11):e029098. doi: 10.1136/bmjopen-2019-029098.
• [14] Motor and sensory neuropathy due to myelin infolding and paranodal damage in a transgenic mouse model of Charcot-Marie-Tooth disease type 1C.Hum Mol Genet. 2013 May 1;22(9):1755-70. doi: 10.1093/hmg/ddt022. Epub 2013 Jan 28.
• [15] Underestimated associated features in CMT neuropathies: clinical indicators for the causative gene?.Brain Behav. 2016 Mar 4;6(4):e00451. doi: 10.1002/brb3.451. eCollection 2016 Apr.
• [16] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [17] Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations.Nat Genet. 2015 Sep;47(9):979-986. doi: 10.1038/ng.3359. Epub 2015 Jul 20.
• [18] Shoe-stiffening inserts for first metatarsophalangeal joint osteoarthritis (the SIMPLE trial): study protocol for a randomised controlled trial.Trials. 2017 Apr 27;18(1):198. doi: 10.1186/s13063-017-1936-1.
• [19] The feedback loop of LITAF and BCL6 is involved in regulating apoptosis in B cell non-Hodgkin's-lymphoma.Oncotarget. 2016 Nov 22;7(47):77444-77456. doi: 10.18632/oncotarget.12680.
• [20] Modifier Gene Candidates in Charcot-Marie-Tooth Disease Type 1A: A Case-Only Genome-Wide Association Study.J Neuromuscul Dis. 2019;6(2):201-211. doi: 10.3233/JND-190377.
• [21] miRNA-106a and prostate cancer radioresistance: a novel role for LITAF in ATM regulation.Mol Oncol. 2018 Aug;12(8):1324-1341. doi: 10.1002/1878-0261.12328. Epub 2018 Jun 14.
• [22] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [23] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [24] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [25] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [26] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [27] Identification of novel low-dose bisphenol a targets in human foreskin fibroblast cells derived from hypospadias patients. PLoS One. 2012;7(5):e36711. doi: 10.1371/journal.pone.0036711. Epub 2012 May 4.
• [28] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [29] The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
• [30] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [31] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [32] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [33] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [34] Nicotine modulates the expression of a diverse set of genes in the neuronal SH-SY5Y cell line. J Biol Chem. 2003 May 2;278(18):15633-40.
• [35] Repurposing L-menthol for systems medicine and cancer therapeutics? L-menthol induces apoptosis through caspase 10 and by suppressing HSP90. OMICS. 2016 Jan;20(1):53-64.
• [36] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [37] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [38] Molecular mechanisms of resveratrol action in lung cancer cells using dual protein and microarray analyses. Cancer Res. 2007 Dec 15;67(24):12007-17. doi: 10.1158/0008-5472.CAN-07-2464.
• [39] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [40] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [41] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [42] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [43] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [44] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [45] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [46] Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
• [47] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.