Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUVH446)

• DOT Name: Probable fibrosin-1 (FBRS)
• Gene Name: FBRS
• Related Disease:
  Acute lymphocytic leukaemia
  Anthrax
  Arteriosclerosis
  Atherosclerosis
  Carcinoma
  Cardiovascular disease
  Glioma
  Glycogen storage disease due to GLUT2 deficiency
  Hyperglycemia
  Lung cancer
  Lung carcinoma
  Neoplasm
  Non-small-cell lung cancer
  Osteoarthritis
  Parkinson disease
  Pituitary dwarfism
  Polycystic ovarian syndrome
  Breast cancer
  Breast carcinoma
  Diabetic retinopathy
  Hepatocellular carcinoma
  Advanced cancer
  Asthma
  Prostate cancer
  Prostate carcinoma
  Schistosomiasis
  Scleroderma
  Systemic sclerosis
  Type-1/2 diabetes
• UniProt ID: FBRS_HUMAN
• Pfam ID: PF15336
• Sequence:
  MFEKYPGKMEGLFRHNPYTAFPPAVPGLPPGLPPAVSFGSLQGAFQPKSTNPELPPRLGP
  VPSGLSQKGTQIPDHFRPPLRKPGKWCAMHVRVAYMILRHQEKMKGDSHKLDFRNDLLPC
  LPGPYGALPPGQELSHPASLFTATGAVHAAANPFTAAPGAHGPFLSPSTHIDPFGRPTSF
  ASLAALSNGAFGGLGSPTFNSGAVFAQKESPGAPPAFASPPDPWGRLHRSPLTFPAWVRP
  PEAARTPGSDKERPVERREPSITKEEKDRDLPFSRPQLRVSPATPKARAGEEGPRPTKES
  VRVKEERKEEAAAAAAAAAAAAAAAAAAATGPQGLHLLFERPRPPPFLGPSPPDRCAGFL
  EPTWLAAPPRLARPPRFYEAGEELTGPGAVAAARLYGLEPAHPLLYSRLAPPPPPAAAPG
  TPHLLSKTPPGALLGAPPPLVPAPRPSSPPRGPGPARADR
• KEGG Pathway: Polycomb repressive complex (hsa03083)

Molecular Interaction Atlas (MIA) of This DOT

29 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acute lymphocytic leukaemia	DISPX75S	Strong	Biomarker	[1]
Anthrax	DISFPT78	Strong	Biomarker	[2]
Arteriosclerosis	DISK5QGC	Strong	Biomarker	[3]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Biomarker	[4]
Cardiovascular disease	DIS2IQDX	Strong	Altered Expression	[5]
Glioma	DIS5RPEH	Strong	Biomarker	[6]
Glycogen storage disease due to GLUT2 deficiency	DISXRSZ1	Strong	Biomarker	[7]
Hyperglycemia	DIS0BZB5	Strong	Genetic Variation	[8]
Lung cancer	DISCM4YA	Strong	Biomarker	[4]
Lung carcinoma	DISTR26C	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[4]
Osteoarthritis	DIS05URM	Strong	Biomarker	[10]
Parkinson disease	DISQVHKL	Strong	Biomarker	[11]
Pituitary dwarfism	DISI019B	Strong	Genetic Variation	[12]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Genetic Variation	[13]
Breast cancer	DIS7DPX1	moderate	Biomarker	[14]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[14]
Diabetic retinopathy	DISHGUJM	moderate	Biomarker	[15]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[16]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[17]
Asthma	DISW9QNS	Limited	Biomarker	[18]
Prostate cancer	DISF190Y	Limited	Biomarker	[19]
Prostate carcinoma	DISMJPLE	Limited	Biomarker	[19]
Schistosomiasis	DIS6PD44	Limited	Biomarker	[20]
Scleroderma	DISVQ342	Limited	Biomarker	[20]
Systemic sclerosis	DISF44L6	Limited	Biomarker	[20]
Type-1/2 diabetes	DISIUHAP	Limited	Genetic Variation	[21]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Probable fibrosin-1 (FBRS).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Probable fibrosin-1 (FBRS).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Probable fibrosin-1 (FBRS).	[24]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Probable fibrosin-1 (FBRS).	[25]
Marinol	DM70IK5	Approved	Marinol increases the expression of Probable fibrosin-1 (FBRS).	[26]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Probable fibrosin-1 (FBRS).	[27]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Probable fibrosin-1 (FBRS).	[28]

References

• [1] Extracellular vesicles derived from natural killer cells use multiple cytotoxic proteins and killing mechanisms to target cancer cells.J Extracell Vesicles. 2019 Mar 12;8(1):1588538. doi: 10.1080/20013078.2019.1588538. eCollection 2019.
• [2] Yeast-hybrid based high-throughput assay for identification of anthrax lethal factor inhibitors.Biochem Biophys Res Commun. 2011 Jan 7;404(1):517-22. doi: 10.1016/j.bbrc.2010.12.015. Epub 2010 Dec 6.
• [3] Different Lifestyle Interventions in AdultsFrom Underserved Communities: The FAMILIA Trial.J Am Coll Cardiol. 2020 Jan 7;75(1):42-56. doi: 10.1016/j.jacc.2019.10.021. Epub 2019 Nov 11.
• [4] Establishment and characterization of primary lung cancer cell lines from Chinese population.Acta Pharmacol Sin. 2011 Mar;32(3):385-92. doi: 10.1038/aps.2010.214.
• [5] The benefits of angiotensin-converting enzyme inhibitors/angiotensin II receptor blockers combined with calcium channel blockers on metabolic, renal, and cardiovascular outcomes in hypertensive patients: a meta-analysis.Int Urol Nephrol. 2018 Dec;50(12):2261-2278. doi: 10.1007/s11255-018-1991-x. Epub 2018 Oct 15.
• [6] Inhibition of JMJD6 expression reduces the proliferation, migration and invasion of neuroglioma stem cells.Neoplasma. 2017;64(5):700-708. doi: 10.4149/neo_2017_507.
• [7] First bite syndrome - An 11-year experience.Auris Nasus Larynx. 2017 Jun;44(3):302-305. doi: 10.1016/j.anl.2016.07.012. Epub 2016 Aug 12.
• [8] Dietary inflammatory index potentially increases blood pressure and markers of glucose homeostasis among adults: findings from an updated systematic review and meta-analysis.Public Health Nutr. 2020 Jun;23(8):1362-1380. doi: 10.1017/S1368980019003070. Epub 2019 Nov 11.
• [9] Tiny Rare-Earth Fluoride Nanoparticles Activate Tumour Cell Growth via Electrical Polar Interactions.Nanoscale Res Lett. 2018 Nov 21;13(1):370. doi: 10.1186/s11671-018-2775-z.
• [10] Autophagy promotes citrullination of VIM (vimentin) and its interaction with major histocompatibility complex class II in synovial fibroblasts.Autophagy. 2020 May;16(5):946-955. doi: 10.1080/15548627.2019.1664144. Epub 2019 Sep 8.
• [11] Bioassay-guided Isolation of Neuroprotective Fatty Acids from Nigella sativa against 1-methyl-4-phenylpyridinium-induced Neurotoxicity.Pharmacogn Mag. 2017 Oct-Dec;13(52):627-633. doi: 10.4103/pm.pm_470_16. Epub 2017 Nov 13.
• [12] Molecular genetic studies in isolated growth hormone deficiency (IGHD).Indian J Pediatr. 2013 Aug;80(8):623-30. doi: 10.1007/s12098-013-0982-2. Epub 2013 Feb 23.
• [13] Polymorphisms and haplotypes of insulin-like factor 3 gene are associated with risk of polycystic ovary syndrome in Indian women.Gene. 2016 Feb 15;577(2):180-6. doi: 10.1016/j.gene.2015.11.033. Epub 2015 Nov 25.
• [14] A comparison of the inhibitory effect of nano-encapsulated helenalin and free helenalin on telomerase gene expression in the breast cancer cell line, by real-time PCR.Artif Cells Nanomed Biotechnol. 2016;44(2):695-703. doi: 10.3109/21691401.2014.981270. Epub 2014 Dec 1.
• [15] Differential expressions of SIRT1, SIRT3, and SIRT4 in peripheral blood mononuclear cells from patients with type 2 diabetic retinopathy.Arch Physiol Biochem. 2020 Oct;126(4):363-368. doi: 10.1080/13813455.2018.1543328. Epub 2018 Dec 20.
• [16] miR-219 regulates liver cancer stem cell expansion via E-cadherin pathway.Cell Cycle. 2019 Dec;18(24):3550-3561. doi: 10.1080/15384101.2019.1691762. Epub 2019 Nov 14.
• [17] Aqueous stable Pd nanoparticles/covalent organic framework nanocomposite: an efficient nanoenzyme for colorimetric detection and multicolor imaging of cancer cells.Nanoscale. 2020 Jan 2;12(2):825-831. doi: 10.1039/c9nr08486j.
• [18] Dual ERK and phosphatidylinositol 3-kinase pathways control airway smooth muscle proliferation: differences in asthma.J Cell Physiol. 2008 Sep;216(3):673-9. doi: 10.1002/jcp.21450.
• [19] Finasteride upregulates expression of androgen receptor in hyperplastic prostate and LNCaP cells: implications for chemoprevention of prostate cancer.Prostate. 2011 Jul;71(10):1115-21. doi: 10.1002/pros.21325. Epub 2011 Jan 12.
• [20] Fibrosin, a novel fibrogenic protein: discovery, cloning and implications for fibrotic disorders.Int Arch Allergy Immunol. 1996 Dec;111(4):326-9. doi: 10.1159/000237388.
• [21] Prevalence of high bloodpressure, hyperglycemia, dyslipidemia, metabolic syndrome and their determinants in Ethiopia: Evidences from the National NCDs STEPS Survey, 2015.PLoS One. 2018 May 9;13(5):e0194819. doi: 10.1371/journal.pone.0194819. eCollection 2018.
• [22] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [26] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [27] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.