Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUZSRVF)

DOT Name Brain and acute leukemia cytoplasmic protein (BAALC)
Gene Name BAALC
Related Disease
Acute myelogenous leukaemia ( )
Acute biphenotypic leukaemia ( )
Acute lymphocytic leukaemia ( )
Acute undifferentiated leukemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Breast carcinoma ( )
Childhood acute lymphoblastic leukemia ( )
Childhood kidney Wilms tumor ( )
Chromosomal disorder ( )
Colon cancer ( )
Colorectal adenocarcinoma ( )
Colorectal cancer ( )
Colorectal cancer, susceptibility to, 1 ( )
Colorectal cancer, susceptibility to, 10 ( )
Colorectal cancer, susceptibility to, 12 ( )
Colorectal carcinoma ( )
Colorectal neoplasm ( )
Glioblastoma multiforme ( )
leukaemia ( )
Leukemia ( )
Promyelocytic leukaemia ( )
T-cell acute lymphoblastic leukaemia ( )
Wilms tumor ( )
Acute leukaemia ( )
Acute monocytic leukemia ( )
Lymphoid leukemia ( )
UniProt ID
BAALC_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF06989
Sequence
MGCGGSRADAIEPRYYESWTRETESTWLTYTDSDAPPSAAAPDSGPEAGGLHSGMLEDGL
PSNGVPRSTAPGGIPNPEKKTNCETQCPNPQSLSSGPLTQKQNGLQTTEAKRDAKRMPAK
EVTINVTDSIQQMDRSRRITKNCVN
Function May play a synaptic role at the postsynaptic lipid rafts possibly through interaction with CAMK2A.
Tissue Specificity
Predominantly expressed in neuroectoderm-derived tissues. Expressed in the brain and spinal cord, and at low levels, in the adrenal gland. In the bone marrow, confined to the CD34+ progenitor cells. Not found in peripheral blood mononuclear cells, nor lymph nodes. Tends to be expressed at high levels in acute myeloid leukemia and glioblastoma cells.

Molecular Interaction Atlas (MIA) of This DOT

27 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Acute myelogenous leukaemia DISCSPTN Definitive Altered Expression [1]
Acute biphenotypic leukaemia DISWE1R7 Strong Altered Expression [2]
Acute lymphocytic leukaemia DISPX75S Strong Altered Expression [3]
Acute undifferentiated leukemia DISJ4SSG Strong Altered Expression [2]
Adult glioblastoma DISVP4LU Strong Altered Expression [4]
Advanced cancer DISAT1Z9 Strong Altered Expression [5]
Breast carcinoma DIS2UE88 Strong Genetic Variation [6]
Childhood acute lymphoblastic leukemia DISJ5D6U Strong Altered Expression [7]
Childhood kidney Wilms tumor DIS0NMK3 Strong Genetic Variation [8]
Chromosomal disorder DISM5BB5 Strong Genetic Variation [9]
Colon cancer DISVC52G Strong Genetic Variation [6]
Colorectal adenocarcinoma DISPQOUB Strong Genetic Variation [6]
Colorectal cancer DISNH7P9 Strong Genetic Variation [6]
Colorectal cancer, susceptibility to, 1 DISZ794C Strong Genetic Variation [6]
Colorectal cancer, susceptibility to, 10 DISQXMYM Strong Genetic Variation [6]
Colorectal cancer, susceptibility to, 12 DIS4FXJX Strong Genetic Variation [6]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [6]
Colorectal neoplasm DISR1UCN Strong Genetic Variation [6]
Glioblastoma multiforme DISK8246 Strong Altered Expression [4]
leukaemia DISS7D1V Strong Altered Expression [10]
Leukemia DISNAKFL Strong Altered Expression [10]
Promyelocytic leukaemia DISYGG13 Strong Genetic Variation [11]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Altered Expression [3]
Wilms tumor DISB6T16 Strong Genetic Variation [8]
Acute leukaemia DISDQFDI Limited Genetic Variation [7]
Acute monocytic leukemia DIS28NEL Limited Biomarker [12]
Lymphoid leukemia DIS65TYQ Limited Altered Expression [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 27 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Brain and acute leukemia cytoplasmic protein (BAALC). [14]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Brain and acute leukemia cytoplasmic protein (BAALC). [17]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Brain and acute leukemia cytoplasmic protein (BAALC). [22]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Brain and acute leukemia cytoplasmic protein (BAALC). [23]
------------------------------------------------------------------------------------
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [15]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [16]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [18]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [19]
Carbamazepine DMZOLBI Approved Carbamazepine affects the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [20]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [21]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Brain and acute leukemia cytoplasmic protein (BAALC). [24]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)

References

1 BAALC and ERG expression levels at diagnosis have no prognosis impact on acute myeloid leukemia patients undergoing allogeneic hematopoietic stem cell transplantation.Ann Hematol. 2018 Aug;97(8):1391-1397. doi: 10.1007/s00277-018-3331-8. Epub 2018 Apr 25.
2 Acute leukemias of ambiguous lineage in adults: molecular and clinical characterization.Ann Hematol. 2013 Jun;92(6):747-58. doi: 10.1007/s00277-013-1694-4. Epub 2013 Feb 15.
3 High BAALC expression predicts chemoresistance in adult B-precursor acute lymphoblastic leukemia.Blood. 2010 May 6;115(18):3737-44. doi: 10.1182/blood-2009-09-241943. Epub 2010 Jan 11.
4 Heritable polymorphism predisposes to high BAALC expression in acute myeloid leukemia.Proc Natl Acad Sci U S A. 2012 Apr 24;109(17):6668-73. doi: 10.1073/pnas.1203756109. Epub 2012 Apr 9.
5 BAALC and ERG expression levels are associated with outcome and distinct gene and microRNA expression profiles in older patients with de novo cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.Blood. 2010 Dec 16;116(25):5660-9. doi: 10.1182/blood-2010-06-290536. Epub 2010 Sep 14.
6 Genetic susceptibility markers for a breast-colorectal cancer phenotype: Exploratory results from genome-wide association studies.PLoS One. 2018 Apr 26;13(4):e0196245. doi: 10.1371/journal.pone.0196245. eCollection 2018.
7 Evaluation of rs62527607 [GT] single nucleotide polymorphism located in BAALC gene in children with acute leukemia using mismatch PCR-RFLP.Cancer Genet. 2016 Jul-Aug;209(7-8):348-53. doi: 10.1016/j.cancergen.2016.06.005. Epub 2016 Jun 16.
8 WT1 overexpression at diagnosis may predict favorable outcome in patients with de novo non-M3 acute myeloid leukemia.Leuk Lymphoma. 2011 Oct;52(10):1961-9. doi: 10.3109/10428194.2011.585673.
9 Feasibility of the AML profiler (Skyline?Array) for patient risk stratification in a multicentre trial: a preliminary comparison with the conventional approach.Hematol Oncol. 2017 Dec;35(4):778-788. doi: 10.1002/hon.2304. Epub 2016 May 3.
10 Histone post-translational modifications associated to BAALC expression in leukemic cells.Biochem Biophys Res Commun. 2012 Jan 13;417(2):721-5. doi: 10.1016/j.bbrc.2011.12.013. Epub 2011 Dec 14.
11 Clinical impact of BAALC expression in high-risk acute promyelocytic leukemia.Blood Adv. 2017 Sep 15;1(21):1807-1814. doi: 10.1182/bloodadvances.2017005926. eCollection 2017 Sep 26.
12 The expression level of BAALC-associated microRNA miR-3151 is an independent prognostic factor in younger patients with cytogenetic intermediate-risk acute myeloid leukemia.Blood Cancer J. 2015 Oct 2;5(10):e352. doi: 10.1038/bcj.2015.76.
13 Low ERG and BAALC expression identifies a new subgroup of adult acute T-lymphoblastic leukemia with a highly favorable outcome.J Clin Oncol. 2007 Aug 20;25(24):3739-45. doi: 10.1200/JCO.2007.11.5253. Epub 2007 Jul 23.
14 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
15 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
16 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
17 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
18 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
19 Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
20 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
21 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
22 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
23 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
24 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.