Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTVV1YV9)

• DOT Name: Phosphoserine aminotransferase (PSAT1)
• Synonyms: EC 2.6.1.52; Phosphohydroxythreonine aminotransferase; PSAT
• Gene Name: PSAT1
• Related Disease:
  Neurometabolic disorder due to serine deficiency
  Neu-Laxova syndrome 1
  PSAT deficiency
  Neu-Laxova syndrome 2
  Neu-Laxova syndrome
• UniProt ID: SERC_HUMAN
• PDB ID: 3E77; 8A5V; 8A5W
• EC Number: 2.6.1.52
• Pfam ID: PF00266
• Sequence:
  MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLV
  RELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGT
  INIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSN
  FLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLY
  NTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSK
  MNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAF
  MKKFLEMHQL
• Function: Involved in L-serine biosynthesis via the phosphorylated pathway, a three-step pathway converting the glycolytic intermediate 3-phospho-D-glycerate into L-serine. Catalyzes the second step, that is the pyridoxal 5'-phosphate-dependent transamination of 3-phosphohydroxypyruvate and L-glutamate to O-phosphoserine (OPS) and alpha-ketoglutarate.
• Tissue Specificity: Expressed at high levels in the brain, liver, kidney and pancreas, and very weakly expressed in the thymus, prostate, testis and colon.
• KEGG Pathway:
  Glycine, serine and threonine metabolism (hsa00260)
  Cysteine and methionine metabolism (hsa00270)
  Vitamin B6 metabolism (hsa00750)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Biosynthesis of amino acids (hsa01230)
  Biosynthesis of cofactors (hsa01240)
• Reactome Pathway: Serine biosynthesis (R-HSA-977347)
• BioCyc Pathway: MetaCyc:HS05946-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Neurometabolic disorder due to serine deficiency	DISCF5UM	Definitive	Autosomal recessive	[1]
Neu-Laxova syndrome 1	DISM00VW	Strong	Autosomal recessive	[2]
PSAT deficiency	DISNXD8Z	Strong	Autosomal recessive	[2]
Neu-Laxova syndrome 2	DISBF447	Moderate	Autosomal recessive	[3]
Neu-Laxova syndrome	DISKU3GJ	Supportive	Autosomal recessive	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Irinotecan	DMP6SC2	Approved	Phosphoserine aminotransferase (PSAT1) increases the response to substance of Irinotecan.	[40]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Phosphoserine aminotransferase (PSAT1).	[5]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[7]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Phosphoserine aminotransferase (PSAT1).	[8]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[9]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Phosphoserine aminotransferase (PSAT1).	[10]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Phosphoserine aminotransferase (PSAT1).	[11]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Phosphoserine aminotransferase (PSAT1).	[12]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[13]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[14]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Phosphoserine aminotransferase (PSAT1).	[15]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Phosphoserine aminotransferase (PSAT1).	[16]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Phosphoserine aminotransferase (PSAT1).	[17]
Marinol	DM70IK5	Approved	Marinol increases the expression of Phosphoserine aminotransferase (PSAT1).	[18]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Phosphoserine aminotransferase (PSAT1).	[19]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Phosphoserine aminotransferase (PSAT1).	[20]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Phosphoserine aminotransferase (PSAT1).	[21]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Phosphoserine aminotransferase (PSAT1).	[18]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Phosphoserine aminotransferase (PSAT1).	[17]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Phosphoserine aminotransferase (PSAT1).	[22]
Dasatinib	DMJV2EK	Approved	Dasatinib increases the expression of Phosphoserine aminotransferase (PSAT1).	[23]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Phosphoserine aminotransferase (PSAT1).	[24]
Cidofovir	DMA13GD	Approved	Cidofovir increases the expression of Phosphoserine aminotransferase (PSAT1).	[11]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Phosphoserine aminotransferase (PSAT1).	[25]
Ifosfamide	DMCT3I8	Approved	Ifosfamide increases the expression of Phosphoserine aminotransferase (PSAT1).	[11]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Phosphoserine aminotransferase (PSAT1).	[11]
Lucanthone	DMZLBUO	Approved	Lucanthone decreases the expression of Phosphoserine aminotransferase (PSAT1).	[26]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil decreases the expression of Phosphoserine aminotransferase (PSAT1).	[11]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Phosphoserine aminotransferase (PSAT1).	[12]
ANW-32821	DMMJOZD	Phase 2	ANW-32821 increases the expression of Phosphoserine aminotransferase (PSAT1).	[27]
NVP-AUY922	DMTYXQF	Phase 2	NVP-AUY922 increases the expression of Phosphoserine aminotransferase (PSAT1).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Phosphoserine aminotransferase (PSAT1).	[29]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Phosphoserine aminotransferase (PSAT1).	[30]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Phosphoserine aminotransferase (PSAT1).	[31]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Phosphoserine aminotransferase (PSAT1).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Phosphoserine aminotransferase (PSAT1).	[33]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Phosphoserine aminotransferase (PSAT1).	[34]
chloropicrin	DMSGBQA	Investigative	chloropicrin decreases the expression of Phosphoserine aminotransferase (PSAT1).	[35]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Phosphoserine aminotransferase (PSAT1).	[36]
Paraquat	DMR8O3X	Investigative	Paraquat increases the expression of Phosphoserine aminotransferase (PSAT1).	[37]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Phosphoserine aminotransferase (PSAT1).	[38]
Arachidonic acid	DMUOQZD	Investigative	Arachidonic acid increases the expression of Phosphoserine aminotransferase (PSAT1).	[39]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Phosphoserine aminotransferase deficiency: a novel disorder of the serine biosynthesis pathway. Am J Hum Genet. 2007 May;80(5):931-7. doi: 10.1086/517888. Epub 2007 Mar 30.
• [3] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [4] Neu-Laxova syndrome is a heterogeneous metabolic disorder caused by defects in enzymes of the L-serine biosynthesis pathway. Am J Hum Genet. 2014 Sep 4;95(3):285-93. doi: 10.1016/j.ajhg.2014.07.012. Epub 2014 Aug 21.
• [5] Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
• [6] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [7] Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
• [8] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [9] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [10] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [11] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [12] Expression profiling of the estrogen responsive genes in response to phytoestrogens using a customized DNA microarray. FEBS Lett. 2005 Mar 14;579(7):1732-40.
• [13] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [14] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [15] Global effects of inorganic arsenic on gene expression profile in human macrophages. Mol Immunol. 2009 Feb;46(4):649-56.
• [16] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [17] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [18] Inhibiting Heat Shock Proteins Can Potentiate the Cytotoxic Effect of Cannabidiol in Human Glioma Cells. Anticancer Res. 2015 Nov;35(11):5827-37.
• [19] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [20] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [21] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [22] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [23] Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
• [24] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [25] Gene expression profiling of breast cancer cells in response to gemcitabine: NF-kappaB pathway activation as a potential mechanism of resistance. Breast Cancer Res Treat. 2007 Apr;102(2):157-72.
• [26] Lucanthone is a novel inhibitor of autophagy that induces cathepsin D-mediated apoptosis. J Biol Chem. 2011 Feb 25;286(8):6602-13.
• [27] Human Mincle Binds to Cholesterol Crystals and Triggers Innate Immune Responses. J Biol Chem. 2015 Oct 16;290(42):25322-32. doi: 10.1074/jbc.M115.645234. Epub 2015 Aug 20.
• [28] Impact of Heat Shock Protein 90 Inhibition on the Proteomic Profile of Lung Adenocarcinoma as Measured by Two-Dimensional Electrophoresis Coupled with Mass Spectrometry. Cells. 2019 Jul 31;8(8):806. doi: 10.3390/cells8080806.
• [29] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [30] BET bromodomain inhibition targets both c-Myc and IL7R in high-risk acute lymphoblastic leukemia. Blood. 2012 Oct 4;120(14):2843-52.
• [31] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [32] Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
• [33] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [34] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [35] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [36] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [37] CD34+ derived macrophage and dendritic cells display differential responses to paraquat. Toxicol In Vitro. 2021 Sep;75:105198. doi: 10.1016/j.tiv.2021.105198. Epub 2021 Jun 9.
• [38] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [39] Arachidonic acid-induced gene expression in colon cancer cells. Carcinogenesis. 2006 Oct;27(10):1950-60.
• [40] Gene expression analysis using human cancer xenografts to identify novel predictive marker genes for the efficacy of 5-fluorouracil-based drugs. Cancer Sci. 2006 Jun;97(6):510-22. doi: 10.1111/j.1349-7006.2006.00204.x.