Details of the Drug

General Information of Drug (ID: DMUTZ8S)

Drug Name
Interferon Alfa-2a, Recombinant
Synonyms Roferon A (TN)
Indication
Disease Entry ICD 11 Status REF
Chronic HCV-1 infection 1E51.1 Approved [1]
Therapeutic Class
Anticancer Agents
Sequence
CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
Cross-matching ID
TTD ID
D09PMV

Molecular Interaction Atlas of This Drug


Drug Therapeutic Target (DTT)
DTT Name DTT ID UniProt ID MOA REF
Fibroblast growth factor receptor 2 (FGFR2) TTGJVQM FGFR2_HUMAN Binder [2]
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease Chronic HCV-1 infection
ICD Disease Classification 1E51.1
Molecule Name Molecule Type Gene Name p-value Fold-Change Z-score
Fibroblast growth factor receptor 2 (FGFR2) DTT FGFR2 4.82E-01 -0.03 -0.2
Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Interferon Alfa-2a, Recombinant (Comorbidity)
DDI Drug Name DDI Drug ID Severity Mechanism Comorbidity REF
Remdesivir DMBFZ6L Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Remdesivir. 1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019] [13]
Thioguanine DM7NKEV Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Thioguanine. Acute myeloid leukaemia [2A60] [14]
Bedaquiline DM3906J Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Bedaquiline. Antimicrobial drug resistance [MG50-MG52] [15]
Aminophylline DML2NIB Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Aminophylline mediated inhibition of CYP450 enzyme. Asthma [CA23] [16]
Roflumilast DMPGHY8 Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Roflumilast. Asthma [CA23] [17]
Pexidartinib DMS2J0Z Major Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Pexidartinib. Bone/articular cartilage neoplasm [2F7B] [18]
PMID27977313-Compound-29 DMIF7KG Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and PMID27977313-Compound-29. Discovery agent [N.A.] [19]
PMID28870136-Compound-48 DMPIM9L Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme. Discovery agent [N.A.] [16]
Cannabidiol DM0659E Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Cannabidiol. Epileptic encephalopathy [8A62] [17]
Brentuximab vedotin DMWLC57 Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Brentuximab vedotin. Hodgkin lymphoma [2B30] [20]
Efavirenz DMC0GSJ Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Efavirenz. Human immunodeficiency virus disease [1C60-1C62] [21]
Zalcitabine DMH7MUV Moderate Increased risk of peripheral neuropathy by the combination of Interferon Alfa-2a, Recombinant and Zalcitabine. Human immunodeficiency virus disease [1C60-1C62] [22]
Mipomersen DMGSRN1 Major Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Mipomersen. Hyper-lipoproteinaemia [5C80] [23]
Teriflunomide DMQ2FKJ Major Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Teriflunomide. Hyper-lipoproteinaemia [5C80] [24]
BMS-201038 DMQTAGO Major Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and BMS-201038. Hyper-lipoproteinaemia [5C80] [25]
Polyethylene glycol DM4I1JP Moderate Increased risk of lowers seizure threshold by the combination of Interferon Alfa-2a, Recombinant and Polyethylene glycol. Irritable bowel syndrome [DD91] [26]
Methotrexate DM2TEOL Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Methotrexate. Leukaemia [2A60-2B33] [17]
Denosumab DMNI0KO Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Denosumab. Low bone mass disorder [FB83] [27]
Calaspargase pegol DMQZBXI Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Calaspargase pegol. Malignant haematopoietic neoplasm [2B33] [19]
Cladribine DM3JDRP Major Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Cladribine. Mature B-cell leukaemia [2A82] [17]
Idelalisib DM602WT Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Idelalisib. Mature B-cell leukaemia [2A82] [28]
Alemtuzumab DMZL3IV Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Alemtuzumab. Mature B-cell leukaemia [2A82] [29]
Clofarabine DMCVJ86 Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Clofarabine. Mature B-cell lymphoma [2A85] [30]
Thalidomide DM70BU5 Moderate Increased risk of peripheral neuropathy by the combination of Interferon Alfa-2a, Recombinant and Thalidomide. Multiple myeloma [2A83] [22]
Bortezomib DMNO38U Moderate Increased risk of peripheral neuropathy by the combination of Interferon Alfa-2a, Recombinant and Bortezomib. Multiple myeloma [2A83] [22]
Interferon beta-1a DM1A6RV Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Interferon beta-1a. Multiple sclerosis [8A40] [31]
Tecfidera DM2OVDT Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Tecfidera. Multiple sclerosis [8A40] [32]
Siponimod DM2R86O Major Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Siponimod. Multiple sclerosis [8A40] [33]
Fingolimod DM5JVAN Major Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Fingolimod. Multiple sclerosis [8A40] [34]
Interferon beta-1b DMCN61Z Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Interferon beta-1b. Multiple sclerosis [8A40] [31]
Ocrelizumab DMEZ2KH Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Ocrelizumab. Multiple sclerosis [8A40] [35]
Ozanimod DMT6AM2 Major Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Ozanimod. Multiple sclerosis [8A40] [17]
Omacetaxine mepesuccinate DMPU2WX Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Omacetaxine mepesuccinate. Myeloproliferative neoplasm [2A20] [36]
Bupropion DM5PCS7 Major Increased risk of lowers seizure threshold by the combination of Interferon Alfa-2a, Recombinant and Bupropion. Nicotine use disorder [6C4A] [37]
Tramadol DMRQD04 Major Increased risk of lowers seizure threshold by the combination of Interferon Alfa-2a, Recombinant and Tramadol. Pain [MG30-MG3Z] [38]
Rasagiline DM3WKQ4 Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Rasagiline mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [33]
Ropinirole DMA6S1D Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Ropinirole mediated inhibition of CYP450 enzyme. Parkinsonism [8A00] [39]
Lindane DMB8CNL Moderate Increased risk of lowers seizure threshold by the combination of Interferon Alfa-2a, Recombinant and Lindane. Pediculosis [1G00] [40]
Leflunomide DMR8ONJ Major Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Leflunomide. Rheumatoid arthritis [FA20] [24]
Asenapine DMSQZE2 Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Asenapine mediated inhibition of CYP450 enzyme. Schizophrenia [6A20] [41]
Pimozide DMW83TP Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Pimozide mediated inhibition of CYP450 enzyme. Schizophrenia [6A20] [42]
Trabectedin DMG3Y89 Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Trabectedin. Solid tumour/cancer [2A00-2F9Z] [17]
Naltrexone DMUL45H Moderate Increased risk of hepatotoxicity by the combination of Interferon Alfa-2a, Recombinant and Naltrexone. Substance abuse [6C40] [43]
Anagrelide DMSQ8MD Moderate Decreased metabolism of Interferon Alfa-2a, Recombinant caused by Anagrelide mediated inhibition of CYP450 enzyme. Thrombocytosis [3B63] [44]
Azathioprine DMMZSXQ Moderate Additive immunosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Azathioprine. Transplant rejection [NE84] [33]
Ganciclovir DM1MBYQ Moderate Additive myelosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Ganciclovir. Virus infection [1A24-1D9Z] [33]
Valganciclovir DMS2IUH Moderate Additive myelosuppressive effects by the combination of Interferon Alfa-2a, Recombinant and Valganciclovir. Virus infection [1A24-1D9Z] [33]
⏷ Show the Full List of 47 DDI Information of This Drug

References

1 Natural products as sources of new drugs over the last 25 years. J Nat Prod. 2007 Mar;70(3):461-77.
2 DrugBank: a knowledgebase for drugs, drug actions and drug targets. Nucleic Acids Res. 2008 Jan;36(Database issue):D901-6.
3 Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health Human Services. 2020
4 Keratinocyte growth factor. Expert Opin Biol Ther. 2009 Jun;9(6):779-87.
5 E-3810 is a potent dual inhibitor of VEGFR and FGFR that exerts antitumor activity in multiple preclinical models. Cancer Res. 2011 Feb 15;71(4):1396-405.
6 Emerging drugs for diabetic foot ulcers. Expert Opin Emerg Drugs. 2006 Nov;11(4):709-24.
7 Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
8 Company report (Eli Lilly) (drug: LY2874455)
9 MK-2461, a novel multitargeted kinase inhibitor, preferentially inhibits the activated c-Met receptor. Cancer Res. 2010 Feb 15;70(4):1524-33.
10 A comparison of physicochemical property profiles of marketed oral drugs and orally bioavailable anti-cancer protein kinase inhibitors in clinical development. Curr Top Med Chem. 2007;7(14):1408-22.
11 National Cancer Institute Drug Dictionary (drug id 751593).
12 Corrigendum to 'Targeting FGFR2 with alofanib (RPT835) shows potent activity in tumour models' [Eur J Cancer 61 (2016) 20-28]. Eur J Cancer. 2017 Jan;70:156.
13 European Medicines Agency "Summary on compassionate use. Remdesivir Gilead.".
14 Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
15 Product Information. Hivid (zalcitabine). Roche Laboratories, Nutley, NJ.
16 Jonkman JH, Nicholson KG, Farrow PR, et al "Effects of alpha-interferon on theophylline pharmacokinetics and metabolism." Br J Clin Pharmacol 27 (1989): 795-802. [PMID: 2757895]
17 Cerner Multum, Inc. "UK Summary of Product Characteristics.".
18 Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
19 Bodmer M, Sulz M, Stadlmann S, Droll A, Terracciano L, Krahenbuhl S "Fatal liver failure in an adult patient with acute lymphoblastic leukemia following treatment with L-asparaginase." Digestion 74 (2006): epub. [PMID: 16988508]
20 Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
21 Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
22 Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931]
23 Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
24 Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
25 Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
26 Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
27 Product Information. Lonsurf (tipiracil-trifluridine). Taiho Oncology, Inc., Princeton, NJ.
28 Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
29 Product Information. Campath (alemtuzumab) Berlex, Richmond, CA.
30 Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
31 Product Information. Betaseron (interferon beta-1b). Berlex, Richmond, CA.
32 Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
33 Cerner Multum, Inc. "Australian Product Information.".
34 Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
35 Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
36 Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
37 Sheehan DV, Welch JB, Fishman SM "A case of bupropion-induced seizure." J Nerv Ment Dis 174 (1986): 496-8. [PMID: 3090199]
38 Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
39 Product Information. Noroxin (norfloxacin). Merck &amp Co, Inc, West Point, PA.
40 Cox R, Krupnick J, Bush N, Houpt A "Seizures caused by concomitant use of lindane and dextroamphetamine in a child with attention deficit hyperactivity disorder." J Miss State Med Assoc 41 (2000): 690-2. [PMID: 10974795]
41 Product Information. Fycompa (perampanel). Eisai Inc, Teaneck, NJ.
42 Dresser GK, Spence JD, Bailey DG "Pharmacokinetic-pharmacodynamic consequences and clinical relevance of cytochrome P450 3A4 inhibition." Clin Pharmacokinet 38 (2000): 41-57. [PMID: 10668858]
43 Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.
44 Product Information. Agrylin (anagrelide). Roberts Pharmaceutical Corporation, Eatontown, NJ.