Details of the Drug

General Information of Drug (ID: DMWCQP4)

Drug Name

Interferon Alfa-2b

Synonyms

Intron A; Viraferon

Indication

Disease Entry	ICD 11	Status	REF
Melanoma	2C30	Approved	[1]
------------------------------------------------------------------------------------

Therapeutic Class

Anticancer Agents

Drug Type

Small molecular drug

Sequence

CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMI
QQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMNEDSILAVR
KYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Structure

3D MOL is unavailable

2D MOL

#Ro5 Violations (Lipinski):
1

Molecular Weight

746.5

Logarithm of the Partition Coefficient

Not Available

Rotatable Bond Count

Hydrogen Bond Donor Count

Hydrogen Bond Acceptor Count

ADMET Property

Absorption: The absorption of drug is greater than 80% from intramuscular or subcutaneous injections []
Half-life: The concentration or amount of drug in body reduced by one-half in 2 - 3 hours [2]

Chemical Identifiers

Formula: C16H17Cl3I2N3NaO5S
IUPAC Name: sodium;diiodomethanesulfonate;N-propyl-N-[2-(2,4,6-trichlorophenoxy)ethyl]imidazole-1-carboxamide
Canonical SMILES: CCCN(CCOC1=C(C=C(C=C1Cl)Cl)Cl)C(=O)N2C=CN=C2.C(S(=O)(=O)[O-])(I)I.[Na+]
InChI: InChI=1S/C15H16Cl3N3O2.CH2I2O3S.Na/c1-2-4-20(15(22)21-5-3-19-10-21)6-7-23-14-12(17)8-11(16)9-13(14)18;2-1(3)7(4,5)6;/h3,5,8-10H,2,4,6-7H2,1H3;1H,(H,4,5,6);/q;;+1/p-1
InChIKey: MIXCUJKCXRNYFM-UHFFFAOYSA-M

Cross-matching ID

PubChem CID: 71306834
CAS Number: 98530-12-2
DrugBank ID: DB00105
TTD ID: D0P0WV
ACDINA ID: D01166

Combinatorial Drugs (CBD)

Click to Jump to the Detailed CBD Information of This Drug

Molecular Interaction Atlas of This Drug

Drug Therapeutic Target (DTT)

DTT Name	DTT ID	UniProt ID	MOA	REF
Interferon-alpha 2 (IFNA2)	TTSIUJ9	IFNA2_HUMAN	Modulator	[3]

------------------------------------------------------------------------------------

Drug Off-Target (DOT)

DOT Name	DOT ID	UniProt ID	Interaction	REF
2'-5'-oligoadenylate synthase 1 (OAS1)	OT8ZLOCY	OAS1_HUMAN	Gene/Protein Processing	[4]
Interferon-induced, double-stranded RNA-activated protein kinase (EIF2AK2)	OT8DXMS3	E2AK2_HUMAN	Gene/Protein Processing	[4]
Non-receptor tyrosine-protein kinase TYK2	OTHEOTA8	TYK2_HUMAN	Gene/Protein Processing	[4]
Signal transducer and activator of transcription 1-alpha/beta (STAT1)	OTLMBUZ6	STAT1_HUMAN	Gene/Protein Processing	[4]
Signal transducer and activator of transcription 2 (STAT2)	OTO9G2RZ	STAT2_HUMAN	Post-Translational Modifications	[4]
Signal transducer and activator of transcription 3 (STAT3)	OTAAGKYZ	STAT3_HUMAN	Post-Translational Modifications	[4]
Tyrosine-protein kinase JAK1 (JAK1)	OT0X3D17	JAK1_HUMAN	Gene/Protein Processing	[4]

------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This Drug

Molecular Expression Atlas of This Drug

The Studied Disease

Melanoma

ICD Disease Classification

2C30

Molecule Name	Molecule Type	Gene Name	p-value	Fold-Change	Z-score
Interferon-alpha 2 (IFNA2)	DTT	IFNA2	9.31E-04	0.35	2.05

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This Drug

Drug-Drug Interaction (DDI) Information of This Drug

Coadministration of a Drug Treating the Disease Different from Interferon Alfa-2b (Comorbidity)

DDI Drug Name	DDI Drug ID	Severity	Mechanism	Comorbidity	REF
Remdesivir	DMBFZ6L	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Remdesivir.	1D6YCoronavirus Disease 2019 [1D6YCoronavirus Disease 2019]	[5]
Thioguanine	DM7NKEV	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Thioguanine.	Acute myeloid leukaemia [2A60]	[6]
Bedaquiline	DM3906J	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Bedaquiline.	Antimicrobial drug resistance [MG50-MG52]	[7]
Aminophylline	DML2NIB	Moderate	Decreased metabolism of Interferon alfa-2B caused by Aminophylline mediated inhibition of CYP450 enzyme.	Asthma [CA23]	[5]
Roflumilast	DMPGHY8	Moderate	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Roflumilast.	Asthma [CA23]	[8]
Pexidartinib	DMS2J0Z	Major	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Pexidartinib.	Bone/articular cartilage neoplasm [2F7B]	[9]
Oxtriphylline	DMLHSE3	Moderate	Decreased metabolism of Interferon alfa-2B caused by Oxtriphylline mediated inhibition of CYP450 enzyme.	Cough [MD12]	[5]
PMID28870136-Compound-48	DMPIM9L	Moderate	Decreased metabolism of Interferon alfa-2B caused by PMID28870136-Compound-48 mediated inhibition of CYP450 enzyme.	Discovery agent [N.A.]	[5]
Cannabidiol	DM0659E	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Cannabidiol.	Epileptic encephalopathy [8A62]	[8]
Brentuximab vedotin	DMWLC57	Moderate	Increased risk of peripheral neuropathy by the combination of Interferon alfa-2B and Brentuximab vedotin.	Hodgkin lymphoma [2B30]	[10]
Efavirenz	DMC0GSJ	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Efavirenz.	Human immunodeficiency virus disease [1C60-1C62]	[11]
Zalcitabine	DMH7MUV	Moderate	Increased risk of peripheral neuropathy by the combination of Interferon alfa-2B and Zalcitabine.	Human immunodeficiency virus disease [1C60-1C62]	[12]
Mipomersen	DMGSRN1	Major	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Mipomersen.	Hyper-lipoproteinaemia [5C80]	[13]
Teriflunomide	DMQ2FKJ	Major	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Teriflunomide.	Hyper-lipoproteinaemia [5C80]	[14]
BMS-201038	DMQTAGO	Major	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and BMS-201038.	Hyper-lipoproteinaemia [5C80]	[15]
Ramelteon	DM7IW9J	Moderate	Decreased metabolism of Interferon alfa-2B caused by Ramelteon mediated inhibition of CYP450 enzyme.	Insomnia [7A00-7A0Z]	[16]
Polyethylene glycol	DM4I1JP	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon alfa-2B and Polyethylene glycol.	Irritable bowel syndrome [DD91]	[17]
Methotrexate	DM2TEOL	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Methotrexate.	Leukaemia [2A60-2B33]	[8]
Denosumab	DMNI0KO	Moderate	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Denosumab.	Low bone mass disorder [FB83]	[18]
Calaspargase pegol	DMQZBXI	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Calaspargase pegol.	Malignant haematopoietic neoplasm [2B33]	[19]
Cladribine	DM3JDRP	Major	Additive myelosuppressive effects by the combination of Interferon alfa-2B and Cladribine.	Mature B-cell leukaemia [2A82]	[8]
Idelalisib	DM602WT	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Idelalisib.	Mature B-cell leukaemia [2A82]	[20]
Clofarabine	DMCVJ86	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Clofarabine.	Mature B-cell lymphoma [2A85]	[21]
Thalidomide	DM70BU5	Moderate	Increased risk of peripheral neuropathy by the combination of Interferon alfa-2B and Thalidomide.	Multiple myeloma [2A83]	[12]
Bortezomib	DMNO38U	Moderate	Increased risk of peripheral neuropathy by the combination of Interferon alfa-2B and Bortezomib.	Multiple myeloma [2A83]	[12]
Tecfidera	DM2OVDT	Moderate	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Tecfidera.	Multiple sclerosis [8A40]	[22]
Siponimod	DM2R86O	Major	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Siponimod.	Multiple sclerosis [8A40]	[5]
Fingolimod	DM5JVAN	Major	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Fingolimod.	Multiple sclerosis [8A40]	[23]
Ocrelizumab	DMEZ2KH	Moderate	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Ocrelizumab.	Multiple sclerosis [8A40]	[24]
Ozanimod	DMT6AM2	Major	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Ozanimod.	Multiple sclerosis [8A40]	[8]
Omacetaxine mepesuccinate	DMPU2WX	Moderate	Additive myelosuppressive effects by the combination of Interferon alfa-2B and Omacetaxine mepesuccinate.	Myeloproliferative neoplasm [2A20]	[25]
Bupropion	DM5PCS7	Major	Increased risk of lowers seizure threshold by the combination of Interferon alfa-2B and Bupropion.	Nicotine use disorder [6C4A]	[26]
Tramadol	DMRQD04	Major	Increased risk of lowers seizure threshold by the combination of Interferon alfa-2B and Tramadol.	Pain [MG30-MG3Z]	[27]
Rasagiline	DM3WKQ4	Moderate	Decreased metabolism of Interferon alfa-2B caused by Rasagiline mediated inhibition of CYP450 enzyme.	Parkinsonism [8A00]	[5]
Ropinirole	DMA6S1D	Moderate	Decreased metabolism of Interferon alfa-2B caused by Ropinirole mediated inhibition of CYP450 enzyme.	Parkinsonism [8A00]	[28]
Lindane	DMB8CNL	Moderate	Increased risk of lowers seizure threshold by the combination of Interferon alfa-2B and Lindane.	Pediculosis [1G00]	[29]
Trabectedin	DMG3Y89	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Trabectedin.	Solid tumour/cancer [2A00-2F9Z]	[8]
Naltrexone	DMUL45H	Moderate	Increased risk of hepatotoxicity by the combination of Interferon alfa-2B and Naltrexone.	Substance abuse [6C40]	[30]
Tizanidine	DMR2IQ4	Major	Decreased metabolism of Interferon alfa-2B caused by Tizanidine mediated inhibition of CYP450 enzyme.	Tonus and reflex abnormality [MB47]	[31]
Azathioprine	DMMZSXQ	Moderate	Additive immunosuppressive effects by the combination of Interferon alfa-2B and Azathioprine.	Transplant rejection [NE84]	[5]
Ganciclovir	DM1MBYQ	Moderate	Additive myelosuppressive effects by the combination of Interferon alfa-2B and Ganciclovir.	Virus infection [1A24-1D9Z]	[5]
Valganciclovir	DMS2IUH	Moderate	Additive myelosuppressive effects by the combination of Interferon alfa-2B and Valganciclovir.	Virus infection [1A24-1D9Z]	[5]
-----------


⏷ Show the Full List of 42 DDI Information of This Drug

Drug Inactive Ingredient(s) (DIG) and Formulation(s) of This Drug

DIG

DIG Name	DIG ID	PubChem CID	Functional Classification
Metacresol	E00016	342	Antimicrobial preservative
Disodium hydrogenorthophosphate	E00283	24203	Buffering agent; Complexing agent
Edetate disodium	E00186	8759	Complexing agent
Polysorbate 80	E00665	Not Available	Dispersing agent; Emollient; Emulsifying agent; Plasticizing agent; Solubilizing agent; Surfactant; Suspending agent
Saccharose	E00091	5988	Binding agent; Coating agent; Cryoprotectant; Diluent; Flavoring agent; Suspending agent; Viscosity-controlling agent
Sodium chloride	E00077	5234	Diluent; Tonicity agent
Sodium dihydrogenorthophosphate	E00559	23672064	Buffering agent; Complexing agent
Water	E00035	962	Solvent
--------------------


⏷ Show the Full List of 8 Pharmaceutical Excipients of This Drug

Pharmaceutical Formulation

Formulation Name	Drug Dosage	Dosage Form	Route
Interferon Alfa-2B 10miu/vial powder For Injection	10miu/vial	Powder For Injection	Intramuscular; Subcutaneous; Intralesional; Intravenous
Interferon Alfa-2B 50ug/0.5ml solution	50ug/0.5ml	Solution	Subcutaneous

Jump to Detail Pharmaceutical Formulation Page of This Drug

References

1	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
2	Trend Analysis of a Database of Intravenous Pharmacokinetic Parameters in Humans for 1352 Drug Compounds
3	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
4	6-Hydroxy-3-O-methyl-kaempferol 6-O-glucopyranoside potentiates the anti-proliferative effect of interferon / by promoting activation of the JAK/STAT signaling by inhibiting SOCS3 in hepatocellular carcinoma cells. Toxicol Appl Pharmacol. 2017 Dec 1;336:31-39. doi: 10.1016/j.taap.2017.10.004. Epub 2017 Oct 12.
5	Cerner Multum, Inc. "Australian Product Information.".
6	Product Information. Aubagio (teriflunomide). Genzyme Corporation, Cambridge, MA.
7	Product Information. Sirturo (bedaquiline). Janssen Pharmaceuticals, Titusville, NJ.
8	Cerner Multum, Inc. "UK Summary of Product Characteristics.".
9	Product Information. Turalio (pexidartinib). Daiichi Sankyo, Inc., Parsippany, NJ.
10	Product Information. Accolate (zafirlukast). Zeneca Pharmaceuticals, Wilmington, DE.
11	Elsharkawy AM, Schwab U, McCarron B, et al. "Efavirenz induced acute liver failure requiring liver transplantation in a slow drug metaboliser." J Clin Virol 58 (2013): 331-3. [PMID: 23763943]
12	Argov Z, Mastaglia FL "Drug-induced peripheral neuropathies." Br Med J 1 (1979): 663-6. [PMID: 219931]
13	Product Information. Kynamro (mipomersen). Genzyme Corporation, Cambridge, MA.
14	Product Information. Arava (leflunomide). Hoechst Marion-Roussel Inc, Kansas City, MO.
15	Product Information. Juxtapid (lomitapide). Aegerion Pharmaceuticals Inc, Cambridge, MA.
16	Product Information. Rozerem (ramelteon). Takeda Pharmaceuticals America, Lincolnshire, IL.
17	Product Information. Suprep Bowel Prep Kit (magnesium/potassium/sodium sulfates). Braintree Laboratories, Braintree, MA.
18	Product Information. Prolia (denosumab). Amgen USA, Thousand Oaks, CA.
19	Al-Nawakil C, Willems L, Mauprivez C, et.al "Successful treatment of l-asparaginase-induced severe acute hepatotoxicity using mitochondrial cofactors." Leuk Lymphoma 55 (2014): 1670-4. [PMID: 24090500]
20	Product Information. Zydelig (idelalisib). Gilead Sciences, Foster City, CA.
21	Product Information. Clolar (clofarabine). sanofi-aventis, Bridgewater, NJ.
22	Product Information. Vumerity (diroximel fumarate). Alkermes, Inc, Cambridge, MA.
23	Product Information. Gilenya (fingolimod). Novartis Pharmaceuticals, East Hanover, NJ.
24	Product Information. Ocrevus (ocrelizumab). Genentech, South San Francisco, CA.
25	Product Information. Synribo (omacetaxine). Teva Pharmaceuticals USA, North Wales, PA.
26	Product Information. Wellbutrin XL (buPROPion). GlaxoSmithKline, Philadelphia, PA.
27	Product Information. Ultram (tramadol). McNeil Pharmaceutical, Raritan, NJ.
28	Product Information. Noroxin (norfloxacin). Merck & Co, Inc, West Point, PA.
29	Matsuoka LY "Convulsions following application of gamma benzene hexachloride." J Am Acad Dermatol 5 (1981): 98-9. [PMID: 6168673]
30	Product Information. ReVia (naltrexone). DuPont Pharmaceuticals, Wilmington, DE.
31	Granfors MT, Backman JT, Laitila J, Neuvonen PJ "Tizanidine is mainly metabolized by cytochrome P450 1A2 in vitro." Br J Clin Pharmacol 57 (2004): 349-53. [PMID: 14998432]