Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAAGKYZ)

• DOT Name: Signal transducer and activator of transcription 3 (STAT3)
• Synonyms: Acute-phase response factor
• Gene Name: STAT3
• Related Disease:
  Hyper-IgE recurrent infection syndrome 1, autosomal dominant
  STAT3-related early-onset multisystem autoimmune disease
  Permanent neonatal diabetes mellitus
• UniProt ID: STAT3_HUMAN
• PDB ID: 5AX3; 5U5S; 6NJS; 6NUQ; 6QHD; 6TLC
• Pfam ID: PF00017 ; PF01017 ; PF02864 ; PF02865 ; PF21354
• Sequence:
  MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
  LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
  TAAQQGGQANHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
  SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSAMEYVQKTLTDEEL
  ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
  HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
  QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
  GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
  NMLTNNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
  GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
  KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
  DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
  TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM
• Function: Signal transducer and transcription activator that mediates cellular responses to interleukins, KITLG/SCF, LEP and other growth factors. Once activated, recruits coactivators, such as NCOA1 or MED1, to the promoter region of the target gene. May mediate cellular responses to activated FGFR1, FGFR2, FGFR3 and FGFR4. Upon activation of IL6ST/gp130 signaling by interleukin-6 (IL6), binds to the IL6-responsive elements identified in the promoters of various acute-phase protein genes. Activated by IL31 through IL31RA. Acts as a regulator of inflammatory response by regulating differentiation of naive CD4(+) T-cells into T-helper Th17 or regulatory T-cells (Treg): acetylation promotes its transcription activity and cell differentiation while deacetylation and oxidation of lysine residues by LOXL3 inhibits differentiation. Involved in cell cycle regulation by inducing the expression of key genes for the progression from G1 to S phase, such as CCND1. Mediates the effects of LEP on melanocortin production, body energy homeostasis and lactation. May play an apoptotic role by transctivating BIRC5 expression under LEP activation. Cytoplasmic STAT3 represses macroautophagy by inhibiting EIF2AK2/PKR activity. Plays a crucial role in basal beta cell functions, such as regulation of insulin secretion. Following JAK/STAT signaling activation and as part of a complex with NFATC3 and NFATC4, binds to the alpha-beta E4 promoter region of CRYAB and activates transcription in cardiomyocytes.
• Tissue Specificity: Heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. Expressed in naive CD4(+) T cells as well as T-helper Th17, Th1 and Th2 cells .
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  Chemokine sig.ling pathway (hsa04062)
  HIF-1 sig.ling pathway (hsa04066)
  FoxO sig.ling pathway (hsa04068)
  Necroptosis (hsa04217)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  JAK-STAT sig.ling pathway (hsa04630)
  Th17 cell differentiation (hsa04659)
  Prolactin sig.ling pathway (hsa04917)
  Adipocytokine sig.ling pathway (hsa04920)
  Insulin resistance (hsa04931)
  AGE-RAGE sig.ling pathway in diabetic complications (hsa04933)
  Growth hormone synthesis, secretion and action (hsa04935)
  Toxoplasmosis (hsa05145)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Measles (hsa05162)
  Human cytomegalovirus infection (hsa05163)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Epstein-Barr virus infection (hsa05169)
  Coro.virus disease - COVID-19 (hsa05171)
  Pathways in cancer (hsa05200)
  Viral carcinogenesis (hsa05203)
  Proteoglycans in cancer (hsa05205)
  MicroR.s in cancer (hsa05206)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Pancreatic cancer (hsa05212)
  Acute myeloid leukemia (hsa05221)
  Non-small cell lung cancer (hsa05223)
  PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235)
  Inflammatory bowel disease (hsa05321)
  Lipid and atherosclerosis (hsa05417)
• Reactome Pathway:
  BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members (R-HSA-111453)
  Interleukin-7 signaling (R-HSA-1266695)
  Signaling by SCF-KIT (R-HSA-1433557)
  Signaling by cytosolic FGFR1 fusion mutants (R-HSA-1839117)
  Downstream signal transduction (R-HSA-186763)
  Signalling to STAT3 (R-HSA-198745)
  Signaling by ALK (R-HSA-201556)
  Senescence-Associated Secretory Phenotype (SASP) (R-HSA-2559582)
  Signaling by Leptin (R-HSA-2586552)
  POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation (R-HSA-2892247)
  Association of TriC/CCT with target proteins during biosynthesis (R-HSA-390471)
  Transcriptional regulation of pluripotent stem cells (R-HSA-452723)
  Interleukin-10 signaling (R-HSA-6783783)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  PTK6 Activates STAT3 (R-HSA-8849474)
  Interleukin-20 family signaling (R-HSA-8854691)
  MET activates STAT3 (R-HSA-8875791)
  Interleukin-15 signaling (R-HSA-8983432)
  Interleukin-35 Signalling (R-HSA-8984722)
  Interleukin-9 signaling (R-HSA-8985947)
  Interleukin-37 signaling (R-HSA-9008059)
  Interleukin-23 signaling (R-HSA-9020933)
  Interleukin-27 signaling (R-HSA-9020956)
  Interleukin-21 signaling (R-HSA-9020958)
  Transcriptional regulation of granulopoiesis (R-HSA-9616222)
  Signaling by phosphorylated juxtamembrane, extracellular and kinase domain KIT mutants (R-HSA-9670439)
  Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants (R-HSA-9673767)
  Signaling by PDGFRA extracellular domain mutants (R-HSA-9673770)
  Signaling by CSF3 (G-CSF) (R-HSA-9674555)
  Signaling by CSF1 (M-CSF) in myeloid cells (R-HSA-9680350)
  STAT3 nuclear events downstream of ALK signaling (R-HSA-9701898)
  Inactivation of CSF3 (G-CSF) signaling (R-HSA-9705462)
  Cytoprotection by HMOX1 (R-HSA-9707564)
  Signaling by ALK fusions and activated point mutants (R-HSA-9725370)
  Nuclear events stimulated by ALK signaling in cancer (R-HSA-9725371)
  Growth hormone receptor signaling (R-HSA-982772)
  PKR-mediated signaling (R-HSA-9833482)
  Interleukin-6 signaling (R-HSA-1059683)

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hyper-IgE recurrent infection syndrome 1, autosomal dominant	DISOSTA1	Definitive	Autosomal dominant	[1]
STAT3-related early-onset multisystem autoimmune disease	DISAXTN7	Definitive	Autosomal dominant	[1]
Permanent neonatal diabetes mellitus	DIS5AEXS	Supportive	Autosomal dominant	[2]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Dexamethasone	DMMWZET	Approved	Signal transducer and activator of transcription 3 (STAT3) increases the Injury ADR of Dexamethasone.	[92]
Ethanol	DMDRQZU	Approved	Signal transducer and activator of transcription 3 (STAT3) increases the Alcohol poisoning ADR of Ethanol.	[92]
Enzalutamide	DMGL19D	Approved	Signal transducer and activator of transcription 3 (STAT3) decreases the response to substance of Enzalutamide.	[93]
Leptin	DM5LY1H	Investigative	Signal transducer and activator of transcription 3 (STAT3) increases the Ovarian cancer ADR of Leptin.	[92]

55 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[9]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[12]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Signal transducer and activator of transcription 3 (STAT3).	[14]
Methotrexate	DM2TEOL	Approved	Methotrexate decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[15]
Decitabine	DMQL8XJ	Approved	Decitabine decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[18]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[19]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[21]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[22]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[23]
Aspirin	DM672AH	Approved	Aspirin decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[24]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[25]
Diclofenac	DMPIHLS	Approved	Diclofenac increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[26]
Nicotine	DMWX5CO	Approved	Nicotine increases the activity of Signal transducer and activator of transcription 3 (STAT3).	[27]
Simvastatin	DM30SGU	Approved	Simvastatin decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[29]
Gemcitabine	DMSE3I7	Approved	Gemcitabine decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[30]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[31]
Vitamin C	DMXJ7O8	Approved	Vitamin C affects the expression of Signal transducer and activator of transcription 3 (STAT3).	[34]
Diphenylpyraline	DMW4X37	Approved	Diphenylpyraline increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[36]
Sertraline	DM0FB1J	Approved	Sertraline decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[37]
Rofecoxib	DM3P5DA	Approved	Rofecoxib increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[38]
Eicosapentaenoic acid/docosa-hexaenoic acid	DMMUCG4	Approved	Eicosapentaenoic acid/docosa-hexaenoic acid decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[41]
Tofacitinib	DMBS370	Approved	Tofacitinib decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[30]
Paroxetine	DM5PVQE	Approved	Paroxetine decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[37]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[49]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[50]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[51]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[52]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[52]
HMPL-004	DM29XGY	Phase 3	HMPL-004 decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[54]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[52]
Contigoside B	DMX9V8K	Phase 2/3	Contigoside B increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[34]
Flavopiridol	DMKSUOI	Phase 2	Flavopiridol decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[59]
Beta-caryophyllene	DM7583A	Phase 2	Beta-caryophyllene decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[61]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[67]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[69]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[71]
AG490	DM3WKO5	Terminated	AG490 decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[76]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[78]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[21]
Coumestrol	DM40TBU	Investigative	Coumestrol decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[79]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[80]
Deguelin	DMXT7WG	Investigative	Deguelin increases the activity of Signal transducer and activator of transcription 3 (STAT3).	[81]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[82]
D-glucose	DMMG2TO	Investigative	D-glucose increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[84]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE increases the expression of Signal transducer and activator of transcription 3 (STAT3).	[85]
ELLAGIC ACID	DMX8BS5	Investigative	ELLAGIC ACID decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[52]
AM251	DMTAWHL	Investigative	AM251 decreases the expression of Signal transducer and activator of transcription 3 (STAT3).	[89]
(E)-4-(3,5-dimethoxystyryl)phenol	DMYXI2V	Investigative	(E)-4-(3,5-dimethoxystyryl)phenol decreases the activity of Signal transducer and activator of transcription 3 (STAT3).	[90]

43 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[11]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[13]
Marinol	DM70IK5	Approved	Marinol decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[17]
Panobinostat	DM58WKG	Approved	Panobinostat increases the acetylation of Signal transducer and activator of transcription 3 (STAT3).	[20]
Dasatinib	DMJV2EK	Approved	Dasatinib decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[28]
Thalidomide	DM70BU5	Approved	Thalidomide decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[33]
Sorafenib	DMS8IFC	Approved	Sorafenib decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[35]
Ritonavir	DMU764S	Approved	Ritonavir decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[39]
Docetaxel	DMDI269	Approved	Docetaxel decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[40]
Crizotinib	DM4F29C	Approved	Crizotinib decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[42]
Masoprocol	DMMVNZ0	Approved	Masoprocol decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[43]
Cotinine	DMCEZ1B	Approved	Cotinine increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[44]
Cetrorelix	DMFD9Q6	Approved	Cetrorelix decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[45]
Cladribine	DM3JDRP	Approved	Cladribine increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[46]
Trametinib	DM2JGQ3	Approved	Trametinib increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[47]
Interferon alfa-2B	DMWCQP4	Approved	Interferon alfa-2B increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[48]
Rigosertib	DMOSTXF	Phase 3	Rigosertib decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[53]
Bardoxolone methyl	DMODA2X	Phase 3	Bardoxolone methyl decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[55]
Dalcetrapib	DMKNCVM	Phase 3	Dalcetrapib increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[56]
Anacetrapib	DMP2BFG	Phase 3	Anacetrapib increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[56]
Thymoquinone	DMVDTR2	Phase 2/3	Thymoquinone decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[57]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[58]
Delphinidin	DMS2WIN	Phase 2	Delphinidin decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[60]
MGCD-0103	DM726HX	Phase 2	MGCD-0103 increases the acetylation of Signal transducer and activator of transcription 3 (STAT3).	[20]
PF-04691502	DMS610L	Phase 2	PF-04691502 decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[62]
AZD1480	DMLK59M	Phase 2	AZD1480 decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[63]
Taurocholic acid	DM2LZ8F	Phase 1/2	Taurocholic acid increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[64]
WP-1066	DMUGHWR	Phase 1/2	WP-1066 decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[65]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Signal transducer and activator of transcription 3 (STAT3).	[66]
Sphingosine-1-Phosphate	DMJCQKA	Phase 1	Sphingosine-1-Phosphate increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[68]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[70]
Flavonoid derivative 1	DMCQP0B	Patented	Flavonoid derivative 1 decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[72]
NSC-87877	DMEYKXL	Patented	NSC-87877 increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[73]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[56]
SB 203580	DMAET6F	Terminated	SB 203580 increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[75]
MANUMYCIN A	DM1SWOY	Terminated	MANUMYCIN A decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[77]
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[70]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[83]
Rapamycin Immunosuppressant Drug	DM678IB	Investigative	Rapamycin Immunosuppressant Drug decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[86]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[87]
Lead acetate	DML0GZ2	Investigative	Lead acetate increases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[88]
Apigenin	DMI3491	Investigative	Apigenin decreases the phosphorylation of Signal transducer and activator of transcription 3 (STAT3).	[91]

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Capsaicin	DMGMF6V	Approved	Capsaicin affects the localization of Signal transducer and activator of transcription 3 (STAT3).	[32]
EMODIN	DMAEDQG	Terminated	EMODIN affects the localization of Signal transducer and activator of transcription 3 (STAT3).	[74]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] An Activating Mutation in STAT3 Results in Neonatal Diabetes Through Reduced Insulin Synthesis. Diabetes. 2017 Apr;66(4):1022-1029. doi: 10.2337/db16-0867. Epub 2017 Jan 10.
• [3] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Response rate of fibrosarcoma cells to cytotoxic drugs on the expression level correlates to the therapeutic response rate of fibrosarcomas and is mediated by regulation of apoptotic pathways. BMC Cancer. 2005 Jul 7;5:74. doi: 10.1186/1471-2407-5-74.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Raloxifene plus 17beta-estradiol inhibits proliferation of primary cultured vascular smooth muscle cells and human mammary endothelial cells via the janus kinase/signal transducer and activator of transcription3 cascade. Eur J Pharmacol. 2007 Apr 30;561(1-3):7-13. doi: 10.1016/j.ejphar.2007.01.026. Epub 2007 Jan 27.
• [9] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [10] Arsenic activates STAT3 signaling during the transformation of the human bronchial epithelial cells. Toxicol Appl Pharmacol. 2022 Feb 1;436:115884. doi: 10.1016/j.taap.2022.115884. Epub 2022 Jan 11.
• [11] Quercetin exerts anti-melanoma activities and inhibits STAT3 signaling. Biochem Pharmacol. 2014 Feb 1;87(3):424-34. doi: 10.1016/j.bcp.2013.11.008. Epub 2013 Nov 23.
• [12] Expression of AFP and STAT3 is involved in arsenic trioxide-induced apoptosis and inhibition of proliferation in AFP-producing gastric cancer cells. PLoS One. 2013;8(1):e54774. doi: 10.1371/journal.pone.0054774. Epub 2013 Jan 30.
• [13] Diesel exhaust particulate-induced activation of Stat3 requires activities of EGFR and Src in airway epithelial cells. Am J Physiol Lung Cell Mol Physiol. 2007 Feb;292(2):L422-9. doi: 10.1152/ajplung.00204.2006. Epub 2006 Oct 6.
• [14] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [15] Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
• [16] 5-Aza-2'-deoxycytidine sensitizes busulfan-resistant myeloid leukemia cells by regulating expression of genes involved in cell cycle checkpoint and apoptosis. Leuk Res. 2010 Mar;34(3):364-72. doi: 10.1016/j.leukres.2009.08.014. Epub 2009 Sep 3.
• [17] Suppression by (9)-tetrahydrocannabinol of the primary immunoglobulin M response by human peripheral blood B cells is associated with impaired STAT3 activation. Toxicology. 2013 Aug 9;310:84-91. doi: 10.1016/j.tox.2013.05.009. Epub 2013 May 29.
• [18] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [19] Transcriptional profiling of MCF7 breast cancer cells in response to 5-Fluorouracil: relationship with cell cycle changes and apoptosis, and identification of novel targets of p53. Int J Cancer. 2006 Sep 1;119(5):1164-75.
• [20] Essential role of HDAC6 in the regulation of PD-L1 in?melanoma. Mol Oncol. 2016 May;10(5):735-750. doi: 10.1016/j.molonc.2015.12.012. Epub 2016 Jan 6.
• [21] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [22] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [23] Cannabidiol Modulates the Immunophenotype and Inhibits the Activation of the Inflammasome in Human Gingival Mesenchymal Stem Cells. Front Physiol. 2016 Nov 24;7:559. doi: 10.3389/fphys.2016.00559. eCollection 2016.
• [24] Expression profile analysis of colon cancer cells in response to sulindac or aspirin. Biochem Biophys Res Commun. 2002 Mar 29;292(2):498-512.
• [25] Long-term nicotine exposure-induced chemoresistance is mediated by activation of Stat3 and downregulation of ERK1/2 via nAChR and beta-adrenoceptors in human bladder cancer cells. Toxicol Sci. 2010 May;115(1):118-30. doi: 10.1093/toxsci/kfq028. Epub 2010 Jan 27.
• [26] Urinary proteomic profiling reveals diclofenac-induced renal injury and hepatic regeneration in mice. Toxicol Appl Pharmacol. 2013 Jun 1;269(2):141-9. doi: 10.1016/j.taap.2013.03.005. Epub 2013 Mar 16.
• [27] Rapid activation of Stat3 and ERK1/2 by nicotine modulates cell proliferation in human bladder cancer cells. Toxicol Sci. 2008 Aug;104(2):283-93. doi: 10.1093/toxsci/kfn086. Epub 2008 Apr 30.
• [28] Targeted inhibition of SRC kinase signaling attenuates pancreatic tumorigenesis. Mol Cancer Ther. 2010 Aug;9(8):2322-32. doi: 10.1158/1535-7163.MCT-09-1212. Epub 2010 Aug 3.
• [29] Simvastatin acts as an inhibitor of interferon gamma-induced cycloxygenase-2 expression in human THP-1 cells, but not in murine RAW264.7 cells. Biocell. 2009 Aug;33(2):107-14.
• [30] EGCG enhances the therapeutic potential of gemcitabine and CP690550 by inhibiting STAT3 signaling pathway in human pancreatic cancer. PLoS One. 2012;7(2):e31067. doi: 10.1371/journal.pone.0031067. Epub 2012 Feb 13.
• [31] Sulindac induces apoptosis and inhibits tumor growth in vivo in head and neck squamous cell carcinoma. Neoplasia. 2007 Mar;9(3):192-9. doi: 10.1593/neo.06781.
• [32] Capsaicin is a novel blocker of constitutive and interleukin-6-inducible STAT3 activation. Clin Cancer Res. 2007 May 15;13(10):3024-32. doi: 10.1158/1078-0432.CCR-06-2575.
• [33] Antimyeloma activity of two novel N-substituted and tetraflourinated thalidomide analogs. Leukemia. 2005 Jul;19(7):1253-61. doi: 10.1038/sj.leu.2403776.
• [34] Improved Preventive Effects of Combined Bioactive Compounds Present in Different Blueberry Varieties as Compared to Single Phytochemicals. Nutrients. 2018 Dec 29;11(1):61. doi: 10.3390/nu11010061.
• [35] Sorafenib derivatives induce apoptosis through inhibition of STAT3 independent of Raf. Eur J Med Chem. 2011 Jul;46(7):2845-51. doi: 10.1016/j.ejmech.2011.04.007. Epub 2011 Apr 14.
• [36] Controlled diesel exhaust and allergen coexposure modulates microRNA and gene expression in humans: Effects on inflammatory lung markers. J Allergy Clin Immunol. 2016 Dec;138(6):1690-1700. doi: 10.1016/j.jaci.2016.02.038. Epub 2016 Apr 24.
• [37] Immunomodulatory effect of selective serotonin reuptake inhibitors (SSRIs) on human T lymphocyte function and gene expression. Eur Neuropsychopharmacol. 2007 Dec;17(12):774-80.
• [38] Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
• [39] The human immunodeficiency virus protease inhibitor ritonavir inhibits lung cancer cells, in part, by inhibition of survivin. J Thorac Oncol. 2011 Apr;6(4):661-70. doi: 10.1097/JTO.0b013e31820c9e3c.
• [40] Sensitization to docetaxel in prostate cancer cells by green tea and quercetin. J Nutr Biochem. 2015 Apr;26(4):408-15. doi: 10.1016/j.jnutbio.2014.11.017. Epub 2015 Jan 15.
• [41] Eicosapentaenoic acid and docosahexaenoic acid inhibit macrophage-induced gastric cancer cell migration by attenuating the expression of matrix metalloproteinase 10. J Nutr Biochem. 2012 Nov;23(11):1434-9. doi: 10.1016/j.jnutbio.2011.09.004. Epub 2012 Jan 27.
• [42] Crizotinib-resistant mutants of EML4-ALK identified through an accelerated mutagenesis screen. Chem Biol Drug Des. 2011 Dec;78(6):999-1005. doi: 10.1111/j.1747-0285.2011.01239.x. Epub 2011 Oct 31.
• [43] Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
• [44] Cotinine, a major nicotine metabolite, induces cell proliferation on urothelium in vitro and in vivo. Toxicology. 2020 Jan 15;429:152325. doi: 10.1016/j.tox.2019.152325. Epub 2019 Nov 1.
• [45] Luteinizing Hormone-Releasing Hormone (LHRH)-I antagonist cetrorelix inhibits myeloma cell growth in vitro and in vivo. Mol Cancer Ther. 2011 Jan;10(1):148-58. doi: 10.1158/1535-7163.MCT-10-0829. Epub 2010 Nov 9.
• [46] Therapeutic potential of cladribine in combination with STAT3 inhibitor against multiple myeloma. BMC Cancer. 2011 Jun 16;11:255. doi: 10.1186/1471-2407-11-255.
• [47] Physapubescin B enhances the sensitivity of gastric cancer cells to trametinib by inhibiting the STAT3 signaling pathway. Toxicol Appl Pharmacol. 2020 Dec 1;408:115273. doi: 10.1016/j.taap.2020.115273. Epub 2020 Oct 6.
• [48] 6-Hydroxy-3-O-methyl-kaempferol 6-O-glucopyranoside potentiates the anti-proliferative effect of interferon / by promoting activation of the JAK/STAT signaling by inhibiting SOCS3 in hepatocellular carcinoma cells. Toxicol Appl Pharmacol. 2017 Dec 1;336:31-39. doi: 10.1016/j.taap.2017.10.004. Epub 2017 Oct 12.
• [49] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [50] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [51] Inhibition of STAT3 expression and signaling in resveratrol-differentiated medulloblastoma cells. Neoplasia. 2008 Jul;10(7):736-44. doi: 10.1593/neo.08304.
• [52] Anti-inflammatory effects of dietary phenolic compounds in an in vitro model of inflamed human intestinal epithelium. Chem Biol Interact. 2010 Dec 5;188(3):659-67.
• [53] Rigosertib as a selective anti-tumor agent can ameliorate multiple dysregulated signaling transduction pathways in high-grade myelodysplastic syndrome. Sci Rep. 2014 Dec 4;4:7310. doi: 10.1038/srep07310.
• [54] Andrographolide causes apoptosis via inactivation of STAT3 and Akt and potentiates antitumor activity of gemcitabine in pancreatic cancer. Toxicol Lett. 2013 Sep 12;222(1):23-35. doi: 10.1016/j.toxlet.2013.06.241. Epub 2013 Jul 8.
• [55] The synthetic triterpenoids CDDO-methyl ester and CDDO-ethyl amide prevent lung cancer induced by vinyl carbamate in A/J mice. Cancer Res. 2007 Mar 15;67(6):2414-9. doi: 10.1158/0008-5472.CAN-06-4534.
• [56] Cholesteryl ester-transfer protein inhibitors stimulate aldosterone biosynthesis in adipocytes through Nox-dependent processes. J Pharmacol Exp Ther. 2015 Apr;353(1):27-34.
• [57] Thymoquinone induces oxidative stress-mediated apoptosis through downregulation of Jak2/STAT3 signaling pathway in human melanoma cells. Food Chem Toxicol. 2021 Nov;157:112604. doi: 10.1016/j.fct.2021.112604. Epub 2021 Oct 7.
• [58] p22phox-dependent NADPH oxidase activity is required for megakaryocytic differentiation. Cell Death Differ. 2010 Dec;17(12):1842-54. doi: 10.1038/cdd.2010.67. Epub 2010 Jun 4.
• [59] Phase 1 and pharmacokinetic study of bolus-infusion flavopiridol followed by cytosine arabinoside and mitoxantrone for acute leukemias. Blood. 2011 Mar 24;117(12):3302-10. doi: 10.1182/blood-2010-09-310862. Epub 2011 Jan 14.
• [60] Delphinidin modulates JAK/STAT3 and MAPKinase signaling to induce apoptosis in HCT116 cells. Environ Toxicol. 2021 Aug;36(8):1557-1566. doi: 10.1002/tox.23152. Epub 2021 May 6.
• [61] -Caryophyllene induces apoptosis and inhibits cell proliferation by deregulation of STAT-3/mTOR/AKT signaling in human bladder cancer cells: An in vitro study. J Biochem Mol Toxicol. 2021 Oct;35(10):e22863. doi: 10.1002/jbt.22863. Epub 2021 Jul 28.
• [62] PF-04691502 triggers cell cycle arrest, apoptosis and inhibits the angiogenesis in hepatocellular carcinoma cells. Toxicol Lett. 2013 Jul 4;220(2):150-6. doi: 10.1016/j.toxlet.2013.04.018. Epub 2013 Apr 29.
• [63] Discovery of 5-chloro-N2-[(1S)-1-(5-fluoropyrimidin-2-yl)ethyl]-N4-(5-methyl-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (AZD1480) as a novel inhibitor of the Jak/Stat pathway. J Med Chem. 2011 Jan 13;54(1):262-76. doi: 10.1021/jm1011319. Epub 2010 Dec 7.
• [64] Sorafenib triggers antiproliferative and pro-apoptotic signals in human esophageal adenocarcinoma cells. Dig Dis Sci. 2008 Dec;53(12):3055-64. doi: 10.1007/s10620-008-0294-y. Epub 2008 May 30.
• [65] WP1066 disrupts Janus kinase-2 and induces caspase-dependent apoptosis in acute myelogenous leukemia cells. Cancer Res. 2007 Dec 1;67(23):11291-9. doi: 10.1158/0008-5472.CAN-07-0593.
• [66] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [67] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [68] S1P facilitates IL-1 production in osteoblasts via the JAK and STAT3 signaling pathways. Environ Toxicol. 2020 Sep;35(9):991-997. doi: 10.1002/tox.22935. Epub 2020 May 13.
• [69] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [70] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [71] Global expression profiling of theophylline response genes in macrophages: evidence of airway anti-inflammatory regulation. Respir Res. 2005 Aug 8;6(1):89. doi: 10.1186/1465-9921-6-89.
• [72] Luteolin enhances paclitaxel-induced apoptosis in human breast cancer MDA-MB-231 cells by blocking STAT3. Chem Biol Interact. 2014 Apr 25;213:60-8. doi: 10.1016/j.cbi.2014.02.002. Epub 2014 Feb 11.
• [73] Osteosarcoma cell proliferation suppression via SHP-2-mediated inactivation of the JAK/STAT3 pathway by tubocapsenolide A. J Adv Res. 2021 Jun 11;34:79-91. doi: 10.1016/j.jare.2021.06.004. eCollection 2021 Dec.
• [74] Emodin inhibits growth and induces apoptosis in an orthotopic hepatocellular carcinoma model by blocking activation of STAT3. Br J Pharmacol. 2013 Oct;170(4):807-21. doi: 10.1111/bph.12302.
• [75] Molecular mechanisms of quinalizarin induces apoptosis and G0/G1 cell cycle of human esophageal cancer HCE-4 cells depends on MAPK, STAT3, and NF-B signaling pathways. Environ Toxicol. 2021 Feb;36(2):276-286. doi: 10.1002/tox.23033. Epub 2020 Oct 8.
• [76] Resveratrol suppresses tumorigenicity and enhances radiosensitivity in primary glioblastoma tumor initiating cells by inhibiting the STAT3 axis. J Cell Physiol. 2012 Mar;227(3):976-93. doi: 10.1002/jcp.22806.
• [77] Manumycin inhibits STAT3, telomerase activity, and growth of glioma cells by elevating intracellular reactive oxygen species generation. Free Radic Biol Med. 2009 Aug 15;47(4):364-74.
• [78] Effect of bisphenol A on the EGFR-STAT3 pathway in MCF-7 breast cancer cells. Mol Med Rep. 2012 Jan;5(1):41-7. doi: 10.3892/mmr.2011.583. Epub 2011 Sep 9.
• [79] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [80] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [81] A novel derivative of the natural agent deguelin for cancer chemoprevention and therapy. Cancer Prev Res (Phila). 2008 Dec;1(7):577-87. doi: 10.1158/1940-6207.CAPR-08-0184.
• [82] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [83] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.
• [84] Resveratrol suppresses the STAT3 signaling pathway and inhibits proliferation of high glucose-exposed HepG2 cells partly through SIRT1. Oncol Rep. 2013 Dec;30(6):2820-8. doi: 10.3892/or.2013.2748. Epub 2013 Sep 20.
• [85] Ethanol potentiates the genotoxicity of the food-derived mammary carcinogen PhIP in human estrogen receptor-positive mammary cells: mechanistic support for lifestyle factors (cooked red meat and ethanol) associated with mammary cancer. Arch Toxicol. 2018 Apr;92(4):1639-1655.
• [86] Mammalian target of rapamycin regulates murine and human cell differentiation through STAT3/p63/Jagged/Notch cascade. J Clin Invest. 2010 Jan;120(1):103-14. doi: 10.1172/JCI37964. Epub 2009 Dec 28.
• [87] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [88] The role of HO-1 in protection against lead-induced neurotoxicity. Neurotoxicology. 2016 Jan;52:1-11. doi: 10.1016/j.neuro.2015.10.015. Epub 2015 Nov 2.
• [89] Cannabinoid derivatives induce cell death in pancreatic MIA PaCa-2 cells via a receptor-independent mechanism. FEBS Lett. 2006 Mar 20;580(7):1733-9.
• [90] Pterostilbene exerts antitumor activity against human osteosarcoma cells by inhibiting the JAK2/STAT3 signaling pathway. Toxicology. 2013 Feb 8;304:120-31. doi: 10.1016/j.tox.2012.12.018. Epub 2013 Jan 8.
• [91] Apigenin Inhibits Cancer Stem Cell-Like Phenotypes in Human Glioblastoma Cells via Suppression of c-Met Signaling. Phytother Res. 2016 Nov;30(11):1833-1840. doi: 10.1002/ptr.5689. Epub 2016 Jul 29.
• [92] ADReCS-Target: target profiles for aiding drug safety research and application. Nucleic Acids Res. 2018 Jan 4;46(D1):D911-D917. doi: 10.1093/nar/gkx899.
• [93] Niclosamide suppresses cell migration and invasion in enzalutamide resistant prostate cancer cells via Stat3-AR axis inhibition. Prostate. 2015 Sep;75(13):1341-53. doi: 10.1002/pros.23015. Epub 2015 May 13.