Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT8LDFWR)

• DOT Name: Galectin-1 (LGALS1)
• Synonyms: Gal-1; 14 kDa laminin-binding protein; HLBP14; 14 kDa lectin; Beta-galactoside-binding lectin L-14-I; Galaptin; HBL; HPL; Lactose-binding lectin 1; Lectin galactoside-binding soluble 1; Putative MAPK-activating protein PM12; S-Lac lectin 1
• Gene Name: LGALS1
• UniProt ID: LEG1_HUMAN
• PDB ID: 1GZW ; 1W6M ; 1W6N ; 1W6O ; 1W6P ; 1W6Q ; 2KM2 ; 2ZKN ; 3OY8 ; 3OYW ; 3T2T ; 3W58 ; 3W59 ; 4Q1P ; 4Q1R ; 4Q26 ; 4Q27 ; 4Q2F ; 4XBL ; 4Y1U ; 4Y1V ; 4Y1X ; 4Y1Y ; 4Y1Z ; 4Y20 ; 4Y22 ; 4Y24 ; 5MWT ; 5MWX ; 6B94 ; 6F83 ; 6M5Y ; 7LTA ; 7NML ; 8B0W ; 8B0Z
• Pfam ID: PF00337
• Sequence:
  MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIV
  CNSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINY
  MAADGDFKIKCVAFD
• Function: Lectin that binds beta-galactoside and a wide array of complex carbohydrates. Plays a role in regulating apoptosis, cell proliferation and cell differentiation. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.
• Tissue Specificity: Expressed in placenta, maternal decidua and fetal membranes. Within placenta, expressed in trophoblasts, stromal cells, villous endothelium, syncytiotrophoblast apical membrane and villous stroma. Within fetal membranes, expressed in amnion, chorioamniotic mesenchyma and chorion (at protein level). Expressed in cardiac, smooth, and skeletal muscle, neurons, thymus, kidney and hematopoietic cells.
• Reactome Pathway:
  Post-translational protein phosphorylation (R-HSA-8957275)
  Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426)

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Galectin-1 (LGALS1).	[1]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Galectin-1 (LGALS1).	[31]

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Galectin-1 (LGALS1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Galectin-1 (LGALS1).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin affects the expression of Galectin-1 (LGALS1).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Galectin-1 (LGALS1).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Galectin-1 (LGALS1).	[6]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Galectin-1 (LGALS1).	[7]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Galectin-1 (LGALS1).	[8]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Galectin-1 (LGALS1).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Galectin-1 (LGALS1).	[10]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Galectin-1 (LGALS1).	[11]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Galectin-1 (LGALS1).	[12]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Galectin-1 (LGALS1).	[13]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Galectin-1 (LGALS1).	[14]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Galectin-1 (LGALS1).	[15]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Galectin-1 (LGALS1).	[16]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the expression of Galectin-1 (LGALS1).	[17]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone affects the expression of Galectin-1 (LGALS1).	[18]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Galectin-1 (LGALS1).	[19]
Malathion	DMXZ84M	Approved	Malathion decreases the expression of Galectin-1 (LGALS1).	[20]
Cyclophosphamide	DM4O2Z7	Approved	Cyclophosphamide increases the expression of Galectin-1 (LGALS1).	[21]
Capsaicin	DMGMF6V	Approved	Capsaicin increases the expression of Galectin-1 (LGALS1).	[22]
Ibuprofen	DM8VCBE	Approved	Ibuprofen affects the expression of Galectin-1 (LGALS1).	[23]
Acocantherin	DM7JT24	Approved	Acocantherin increases the expression of Galectin-1 (LGALS1).	[24]
Racecadotril	DMFOTZ7	Approved	Racecadotril decreases the expression of Galectin-1 (LGALS1).	[26]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Galectin-1 (LGALS1).	[12]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Galectin-1 (LGALS1).	[27]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene increases the expression of Galectin-1 (LGALS1).	[28]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Galectin-1 (LGALS1).	[29]
Camptothecin	DM6CHNJ	Phase 3	Camptothecin decreases the expression of Galectin-1 (LGALS1).	[30]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Galectin-1 (LGALS1).	[27]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Galectin-1 (LGALS1).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Galectin-1 (LGALS1).	[33]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Galectin-1 (LGALS1).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Galectin-1 (LGALS1).	[27]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Galectin-1 (LGALS1).	[35]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Galectin-1 (LGALS1).	[36]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Galectin-1 (LGALS1).	[37]
chloropicrin	DMSGBQA	Investigative	chloropicrin affects the expression of Galectin-1 (LGALS1).	[38]
AHPN	DM8G6O4	Investigative	AHPN decreases the expression of Galectin-1 (LGALS1).	[39]
Chlorpyrifos	DMKPUI6	Investigative	Chlorpyrifos decreases the expression of Galectin-1 (LGALS1).	[26]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Dihydroartemisinin	DMBXVMZ	Approved	Dihydroartemisinin affects the binding of Galectin-1 (LGALS1).	[25]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [8] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [12] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [13] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [14] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [15] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [16] Single-cell Transcriptome Mapping Identifies Common and Cell-type Specific Genes Affected by Acute Delta9-tetrahydrocannabinol in Humans. Sci Rep. 2020 Feb 26;10(1):3450. doi: 10.1038/s41598-020-59827-1.
• [17] Arsenite and cadmium promote the development of mammary tumors. Carcinogenesis. 2020 Jul 14;41(7):1005-1014. doi: 10.1093/carcin/bgz176.
• [18] Proteomic analysis of human adipose tissue after rosiglitazone treatment shows coordinated changes to promote glucose uptake. Obesity (Silver Spring). 2010 Jan;18(1):27-34. doi: 10.1038/oby.2009.208. Epub 2009 Jun 25.
• [19] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [20] Malathion induced cancer-linked gene expression in human lymphocytes. Environ Res. 2020 Mar;182:109131. doi: 10.1016/j.envres.2020.109131. Epub 2020 Jan 10.
• [21] Comparative gene expression analysis of a chronic myelogenous leukemia cell line resistant to cyclophosphamide using oligonucleotide arrays and response to tyrosine kinase inhibitors. Leuk Res. 2007 Nov;31(11):1511-20.
• [22] A comparative proteomic analysis for capsaicin-induced apoptosis between human hepatocarcinoma (HepG2) and human neuroblastoma (SK-N-SH) cells. Proteomics. 2008 Nov;8(22):4748-67. doi: 10.1002/pmic.200800094.
• [23] Protein profile in neuroblastoma cells incubated with S- and R-enantiomers of ibuprofen by iTRAQ-coupled 2-D LC-MS/MS analysis: possible action of induced proteins on Alzheimer's disease. Proteomics. 2008 Apr;8(8):1595-607. doi: 10.1002/pmic.200700556.
• [24] Proteomics investigation of protein expression changes in ouabain induced apoptosis in human umbilical vein endothelial cells. J Cell Biochem. 2008 Jun 1;104(3):1054-64. doi: 10.1002/jcb.21691.
• [25] Untargeted Proteomics and Systems-Based Mechanistic Investigation of Artesunate in Human Bronchial Epithelial Cells. Chem Res Toxicol. 2015 Oct 19;28(10):1903-13. doi: 10.1021/acs.chemrestox.5b00105. Epub 2015 Sep 21.
• [26] Successful validation of genomic biomarkers for human immunotoxicity in Jurkat T cells in vitro. J Appl Toxicol. 2015 Jul;35(7):831-41.
• [27] Gene expression profiling in Ishikawa cells: a fingerprint for estrogen active compounds. Toxicol Appl Pharmacol. 2009 Apr 1;236(1):85-96.
• [28] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [29] Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
• [30] Camptothecin-induced cell proliferation inhibition and apoptosis enhanced by DNA methyltransferase inhibitor, 5-aza-2'-deoxycytidine. Biol Pharm Bull. 2009 Jun;32(6):1105-8. doi: 10.1248/bpb.32.1105.
• [31] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [32] BET bromodomain inhibition as a therapeutic strategy to target c-Myc. Cell. 2011 Sep 16;146(6):904-17.
• [33] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [34] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [35] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [36] Identification of formaldehyde-responsive genes by suppression subtractive hybridization. Toxicology. 2008 Jan 14;243(1-2):224-35.
• [37] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [38] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [39] ST1926, a novel and orally active retinoid-related molecule inducing apoptosis in myeloid leukemia cells: modulation of intracellular calcium homeostasis. Blood. 2004 Jan 1;103(1):194-207.