Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0RSQO4)

DOT Name	Cilia- and flagella-associated protein 97 (CFAP97)
Gene Name	CFAP97
Related Disease	Glioma ( ) Acute otitis media ( ) Alzheimer disease ( ) Carcinoma ( ) Cataract ( ) Chronic kidney disease ( ) Chronic obstructive pulmonary disease ( ) Congenital high-molecular-weight kininogen deficiency ( ) Huntington disease ( ) Influenza ( ) Myocardial infarction ( ) Non-hodgkin lymphoma ( ) Non-small-cell lung cancer ( ) Obesity ( ) Obstructive sleep apnea ( ) Osteoarthritis ( ) Otitis media ( ) Pneumonia ( ) Pneumonitis ( ) Prostate carcinoma ( ) Non-insulin dependent diabetes ( ) Pancreatic cancer ( ) Polycystic ovarian syndrome ( ) Coronary heart disease ( ) Breast cancer ( ) Breast carcinoma ( ) Eclampsia ( ) Neoplasm ( ) Type-1 diabetes ( ) Type-1/2 diabetes ( )
UniProt ID	CFA97_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF13879
Sequence	MDQFGDILEGEVDHSFFDSDFEEGKKCETNSVFDKQNDDPKERIDKDTKNVNSNTGMQTT ENYLTEKGNERNVKFPPEHPVENDVTQTVSSFSLPASSRSKKLCDVTTGLKIHVSIPNRI PKIVKEGEDDYYTDGEESSDDGKKYHVKSKSAKPSTNVKKSIRKKYCKVSSSSSSSLSSS SSGSGTDCLDAGSDSHLSDSSPSSKSSKKHVSGITLLSPKHKYKSGIKSTETQPSSTTPK CGHYPEESEDTVTDVSPLSTPDISPLQSFELGIANDQKVKIKKQENVSQEIYEDVEDLKN NSKYLKAAKKGKEKHEPDVSSKSSSVLDSSLDHRHKQKVLHDTMDLNHLLKAFLQLDKKG PQKHHFDQPSVAPGKNYSFTREEVRQIDRENQRLLKELSRQAEKPGSKSTIPRSADHPPK LYHSALNRQKEQQRIERENLALLKRLEAVKPTVGMKRSEQLMDYHRNMGYLNSSPLSRRA RSTLGQYSPLRASRTSSATSGLSCRSERSAVDPSSGHPRRRPKPPNVRTAWL

Molecular Interaction Atlas (MIA) of This DOT

30 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Glioma	DIS5RPEH	Definitive	Altered Expression	[1]
Acute otitis media	DISL8D8G	Strong	Biomarker	[2]
Alzheimer disease	DISF8S70	Strong	Biomarker	[3]
Carcinoma	DISH9F1N	Strong	Altered Expression	[4]
Cataract	DISUD7SL	Strong	Biomarker	[5]
Chronic kidney disease	DISW82R7	Strong	Genetic Variation	[6]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Biomarker	[7]
Congenital high-molecular-weight kininogen deficiency	DISWXLMY	Strong	Biomarker	[8]
Huntington disease	DISQPLA4	Strong	Altered Expression	[9]
Influenza	DIS3PNU3	Strong	Biomarker	[10]
Myocardial infarction	DIS655KI	Strong	Altered Expression	[11]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[12]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[13]
Obesity	DIS47Y1K	Strong	Biomarker	[14]
Obstructive sleep apnea	DIS0SVD1	Strong	Altered Expression	[15]
Osteoarthritis	DIS05URM	Strong	Biomarker	[16]
Otitis media	DISGZDUO	Strong	Biomarker	[2]
Pneumonia	DIS8EF3M	Strong	Biomarker	[17]
Pneumonitis	DIS88E0K	Strong	Biomarker	[17]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[18]
Non-insulin dependent diabetes	DISK1O5Z	moderate	Biomarker	[14]
Pancreatic cancer	DISJC981	moderate	Biomarker	[19]
Polycystic ovarian syndrome	DISZ2BNG	moderate	Biomarker	[20]
Coronary heart disease	DIS5OIP1	Disputed	Altered Expression	[21]
Breast cancer	DIS7DPX1	Limited	Biomarker	[4]
Breast carcinoma	DIS2UE88	Limited	Biomarker	[4]
Eclampsia	DISWPO8U	Limited	Biomarker	[22]
Neoplasm	DISZKGEW	Limited	Biomarker	[23]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[22]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[24]
------------------------------------------------------------------------------------


⏷ Show the Full List of 30 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[25]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[26]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[27]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[28]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[29]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[30]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[31]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide increases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[32]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[33]
PMID28870136-Compound-48	DMPIM9L	Patented	PMID28870136-Compound-48 increases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[35]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Cilia- and flagella-associated protein 97 (CFAP97).	[37]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of Cilia- and flagella-associated protein 97 (CFAP97).	[34]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Cilia- and flagella-associated protein 97 (CFAP97).	[36]
------------------------------------------------------------------------------------

References

1	Overexpression of high molecular weight FGF-2 forms inhibits glioma growth by acting on cell-cycle progression and protein translation.Exp Cell Res. 2008 Dec 10;314(20):3701-11. doi: 10.1016/j.yexcr.2008.09.022. Epub 2008 Oct 7.
2	Adhesin expression in matched nasopharyngeal and middle ear isolates of nontypeable Haemophilus influenzae from children with acute otitis media.Infect Immun. 1999 Jan;67(1):449-54. doi: 10.1128/IAI.67.1.449-454.1999.
3	Relevance of Phosphorylation and Truncation of Tau to the Etiopathogenesis of Alzheimer's Disease.Front Aging Neurosci. 2018 Feb 6;10:27. doi: 10.3389/fnagi.2018.00027. eCollection 2018.
4	Increased High Molecular Weight FGF2 in Endocrine-Resistant Breast Cancer.Horm Cancer. 2018 Oct;9(5):338-348. doi: 10.1007/s12672-018-0339-4. Epub 2018 Jun 28.
5	Overexpression of human C-crystallin 5 bp duplication disrupts lens morphology in transgenic mice.Invest Ophthalmol Vis Sci. 2011 Jul 23;52(8):5369-75. doi: 10.1167/iovs.11-7168.
6	Electrophoretic patterns of proteinuria in feline spontaneous chronic kidney disease.J Feline Med Surg. 2020 Feb;22(2):114-121. doi: 10.1177/1098612X19827597. Epub 2019 Feb 6.
7	Characterization of adherence of nontypeable Haemophilus influenzae to human epithelial cells.Infect Immun. 2000 Aug;68(8):4658-65. doi: 10.1128/IAI.68.8.4658-4665.2000.
8	Prolonged activated partial thromboplastin time and deficiency of high molecular weight kininogen in brown Norway rat mutant (Katholiek strain).Thromb Res. 1984 Feb 15;33(4):371-7. doi: 10.1016/0049-3848(84)90076-8.
9	MAP2 Splicing is Altered in Huntington's Disease.Brain Pathol. 2017 Mar;27(2):181-189. doi: 10.1111/bpa.12387. Epub 2016 Jul 7.
10	Absence of high molecular weight proteins 1 and/or 2 is associated with decreased adherence among non-typeable Haemophilus influenzae clinical isolates.J Med Microbiol. 2013 Nov;62(Pt 11):1649-1656. doi: 10.1099/jmm.0.058222-0. Epub 2013 Aug 29.
11	Adiponectin gene variants and decreased adiponectin plasma levels are associated with the risk of myocardial infarction in young age.Gene. 2018 Feb 5;642:498-504. doi: 10.1016/j.gene.2017.11.064. Epub 2017 Nov 28.
12	Identification of B-cell growth factors (interleukin-14; high molecular weight-B-cell growth factors) in effusion fluids from patients with aggressive B-cell lymphomas.Blood. 1995 Jul 1;86(1):283-93.
13	Involvement of caspase? in apoptosis enhancement by cotreatment with retinoic acidinducible geneIlike receptor agonist and ionizing radiation in human nonsmall cell lung cancer.Mol Med Rep. 2018 Dec;18(6):5286-5294. doi: 10.3892/mmr.2018.9536. Epub 2018 Oct 8.
14	High molecular weight adiponectin reduces glucolipotoxicity-induced inflammation and improves lipid metabolism and insulin sensitivity via APPL1-AMPK-GLUT4 regulation in 3T3-L1 adipocytes.Atherosclerosis. 2019 Sep;288:67-75. doi: 10.1016/j.atherosclerosis.2019.07.011. Epub 2019 Jul 12.
15	Evaluation of adiponectin profile in Italian patients affected by obstructive sleep apnea syndrome.Pulm Pharmacol Ther. 2016 Oct;40:104-8. doi: 10.1016/j.pupt.2016.07.008. Epub 2016 Jul 25.
16	Amelioration of osteoarthritis by intra-articular hyaluronan synthase 2 gene therapy.Med Hypotheses. 2007;69(5):1111-3. doi: 10.1016/j.mehy.2007.01.084. Epub 2007 Apr 12.
17	High Molecular Weight Hyaluronan Suppresses Macrophage M1 Polarization and Enhances IL-10 Production in PM(2.5)-Induced Lung Inflammation.Molecules. 2019 May 7;24(9):1766. doi: 10.3390/molecules24091766.
18	DC-SCRIPT: AR and VDR regulator lost upon transformation of prostate epithelial cells.Prostate. 2012 Dec 1;72(16):1708-17. doi: 10.1002/pros.22522. Epub 2012 Apr 2.
19	High-molecular-weight hyaluronan produced by activated pancreatic stellate cells promotes pancreatic cancer cell migration via paracrine signaling.Biochem Biophys Res Commun. 2019 Jul 30;515(3):493-498. doi: 10.1016/j.bbrc.2019.05.167. Epub 2019 Jun 3.
20	Polycystic ovary syndrome in adolescent girls.Pediatr Obes. 2020 Feb;15(2):e12586. doi: 10.1111/ijpo.12586. Epub 2019 Oct 30.
21	Circulating levels of adiponectin and extent of coronary artery disease in patients undergoing elective coronary angiography.Braz J Med Biol Res. 2017 Nov 30;51(2):e6738. doi: 10.1590/1414-431X20176738.
22	Circulating adipokines are associated with pre-eclampsia in women with type 1 diabetes.Diabetologia. 2017 Dec;60(12):2514-2524. doi: 10.1007/s00125-017-4415-z. Epub 2017 Sep 5.
23	INK4 locus of the tumor-resistant rodent, the naked mole rat, expresses a functional p15/p16 hybrid isoform.Proc Natl Acad Sci U S A. 2015 Jan 27;112(4):1053-8. doi: 10.1073/pnas.1418203112. Epub 2014 Dec 30.
24	Association between plasma concentrations of branched-chain amino acids and adipokines in Japanese adults without diabetes.Sci Rep. 2018 Jan 18;8(1):1043. doi: 10.1038/s41598-018-19388-w.
25	Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
26	Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
27	Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
28	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
29	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
30	Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
31	Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
32	Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
33	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
34	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
35	Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
36	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
37	From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.