Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT21MF51)

• DOT Name: Integrin beta-5 (ITGB5)
• Gene Name: ITGB5
• Related Disease:
  Adult glioblastoma
  Atherosclerosis
  Bipolar disorder
  Breast cancer
  Breast carcinoma
  Gastric cancer
  Glioblastoma multiforme
  Glioma
  Juvenile idiopathic arthritis
  Major depressive disorder
  Neoplasm
  Polycystic ovarian syndrome
  Schizophrenia
  Stomach cancer
  Systemic sclerosis
  Adenovirus infection
  Advanced cancer
  Hepatocellular carcinoma
  Triple negative breast cancer
• UniProt ID: ITB5_HUMAN
• PDB ID: 7S46; 7S47; 7S48
• Pfam ID: PF18372 ; PF08725 ; PF07965 ; PF00362 ; PF17205
• Sequence:
  MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSI
  TSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRP
  GDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFG
  SFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVS
  RNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGKLGGLVQPHDGQC
  HLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTALIPGTTVEIL
  DGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD
  TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSG
  TYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEF
  GKIYGPFCECDNFSCARNKGVLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQ
  ICSERGHCLCGQCQCTEPGAFGEMCEKCPTCPDACSTKRDCVECLLLHSGKPDNQTCHSL
  CRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELPSGKSNLTVLREPECGNTPNA
  MTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMASNPLYRKPIST
  HTVDFTFNKFNKSYNGTVD
• Function: Integrin alpha-V/beta-5 (ITGAV:ITGB5) is a receptor for fibronectin. It recognizes the sequence R-G-D in its ligand.; (Microbial infection) Integrin ITGAV:ITGB5 acts as a receptor for adenovirus type C.
• KEGG Pathway:
  Phagosome (hsa04145)
  Efferocytosis (hsa04148)
  PI3K-Akt sig.ling pathway (hsa04151)
  Focal adhesion (hsa04510)
  ECM-receptor interaction (hsa04512)
  Regulation of actin cytoskeleton (hsa04810)
  Cytoskeleton in muscle cells (hsa04820)
  Human papillomavirus infection (hsa05165)
  Proteoglycans in cancer (hsa05205)
  Hypertrophic cardiomyopathy (hsa05410)
  Arrhythmogenic right ventricular cardiomyopathy (hsa05412)
  Dilated cardiomyopathy (hsa05414)
• Reactome Pathway:
  Molecules associated with elastic fibres (R-HSA-2129379)
  Integrin cell surface interactions (R-HSA-216083)
  TGF-beta receptor signaling activates SMADs (R-HSA-2173789)
  Syndecan interactions (R-HSA-3000170)
  ECM proteoglycans (R-HSA-3000178)
  Smooth Muscle Contraction (R-HSA-445355)
  Cross-presentation of particulate exogenous antigens (phagosomes) (R-HSA-1236973)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[1]
Atherosclerosis	DISMN9J3	Strong	Biomarker	[2]
Bipolar disorder	DISAM7J2	Strong	Genetic Variation	[3]
Breast cancer	DIS7DPX1	Strong	Biomarker	[4]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[4]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[5]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[1]
Glioma	DIS5RPEH	Strong	Altered Expression	[1]
Juvenile idiopathic arthritis	DISQZGBV	Strong	Biomarker	[6]
Major depressive disorder	DIS4CL3X	Strong	Genetic Variation	[7]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Polycystic ovarian syndrome	DISZ2BNG	Strong	Biomarker	[8]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[3]
Stomach cancer	DISKIJSX	Strong	Genetic Variation	[5]
Systemic sclerosis	DISF44L6	Strong	Biomarker	[9]
Adenovirus infection	DISUYSBZ	moderate	Biomarker	[10]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[11]
Hepatocellular carcinoma	DIS0J828	Limited	Biomarker	[11]
Triple negative breast cancer	DISAMG6N	Limited	Biomarker	[4]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Paclitaxel	DMLB81S	Approved	Integrin beta-5 (ITGB5) decreases the response to substance of Paclitaxel.	[34]

29 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Integrin beta-5 (ITGB5).	[12]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Integrin beta-5 (ITGB5).	[13]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Integrin beta-5 (ITGB5).	[14]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Integrin beta-5 (ITGB5).	[15]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Integrin beta-5 (ITGB5).	[16]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Integrin beta-5 (ITGB5).	[17]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Integrin beta-5 (ITGB5).	[19]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Integrin beta-5 (ITGB5).	[20]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Integrin beta-5 (ITGB5).	[21]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Integrin beta-5 (ITGB5).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Integrin beta-5 (ITGB5).	[22]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Integrin beta-5 (ITGB5).	[12]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Integrin beta-5 (ITGB5).	[23]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Integrin beta-5 (ITGB5).	[24]
Methimazole	DM25FL8	Approved	Methimazole increases the expression of Integrin beta-5 (ITGB5).	[24]
Propylthiouracil	DM6D7N8	Approved	Propylthiouracil decreases the expression of Integrin beta-5 (ITGB5).	[24]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of Integrin beta-5 (ITGB5).	[12]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone decreases the expression of Integrin beta-5 (ITGB5).	[24]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Integrin beta-5 (ITGB5).	[12]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Integrin beta-5 (ITGB5).	[25]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Integrin beta-5 (ITGB5).	[27]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Integrin beta-5 (ITGB5).	[28]
methyl p-hydroxybenzoate	DMO58UW	Investigative	methyl p-hydroxybenzoate decreases the expression of Integrin beta-5 (ITGB5).	[29]
Glyphosate	DM0AFY7	Investigative	Glyphosate decreases the expression of Integrin beta-5 (ITGB5).	[30]
Manganese	DMKT129	Investigative	Manganese increases the expression of Integrin beta-5 (ITGB5).	[31]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Integrin beta-5 (ITGB5).	[32]
Aminohippuric acid	DMUN54G	Investigative	Aminohippuric acid affects the expression of Integrin beta-5 (ITGB5).	[33]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Integrin beta-5 (ITGB5).	[25]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Integrin beta-5 (ITGB5).	[25]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Integrin beta-5 (ITGB5).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Integrin beta-5 (ITGB5).	[26]

References

• [1] Integrin Beta 5 Is a Prognostic Biomarker and Potential Therapeutic Target in Glioblastoma.Front Oncol. 2019 Sep 20;9:904. doi: 10.3389/fonc.2019.00904. eCollection 2019.
• [2] betaig-h3 triggers signaling pathways mediating adhesion and migration of vascular smooth muscle cells through alphavbeta5 integrin.Exp Mol Med. 2006 Apr 30;38(2):153-61. doi: 10.1038/emm.2006.19.
• [3] A multimodal attempt to follow-up linkage regions using RNA expression, SNPs and CpG methylation in schizophrenia and bipolar disorder kindreds.Eur J Hum Genet. 2020 Apr;28(4):499-507. doi: 10.1038/s41431-019-0526-y. Epub 2019 Nov 6.
• [4] Integrin 5 contributes to the tumorigenic potential of breast cancer cells through the Src-FAK and MEK-ERK signaling pathways.Oncogene. 2013 Jun 20;32(25):3049-58. doi: 10.1038/onc.2012.320. Epub 2012 Jul 23.
• [5] Gene expression signature analysis identifies vorinostat as a candidate therapy for gastric cancer.PLoS One. 2011;6(9):e24662. doi: 10.1371/journal.pone.0024662. Epub 2011 Sep 9.
• [6] Gene expression signatures in polyarticular juvenile idiopathic arthritis demonstrate disease heterogeneity and offer a molecular classification of disease subsets.Arthritis Rheum. 2009 Jul;60(7):2113-23. doi: 10.1002/art.24534.
• [7] Dissecting the genetic heterogeneity of depression through age at onset.Am J Med Genet B Neuropsychiatr Genet. 2012 Oct;159B(7):859-68. doi: 10.1002/ajmg.b.32093. Epub 2012 Aug 22.
• [8] RUNX2, GPX3 and PTX3 gene expression profiling in cumulus cells are reflective oocyte/embryo competence and potentially reliable predictors of embryo developmental competence in PCOS patients.Reprod Biol Endocrinol. 2013 Nov 26;11:109. doi: 10.1186/1477-7827-11-109.
• [9] Efferocytosis capacities of blood monocyte-derived macrophages in systemic sclerosis.Immunol Cell Biol. 2019 Mar;97(3):340-347. doi: 10.1111/imcb.12217. Epub 2018 Dec 13.
• [10] Role of genetic susceptibility to latent adenoviral infection and decreased lung function.Respir Med. 2009 Nov;103(11):1672-80. doi: 10.1016/j.rmed.2009.05.008. Epub 2009 Jun 6.
• [11] Integrin-5, a miR-185-targeted gene, promotes hepatocellular carcinoma tumorigenesis by regulating -catenin stability.J Exp Clin Cancer Res. 2018 Jan 31;37(1):17. doi: 10.1186/s13046-018-0691-9.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [14] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [15] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [16] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [17] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [18] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [19] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [20] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [21] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [22] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [23] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [24] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [25] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [26] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [27] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [28] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [29] Transcriptome dynamics of alternative splicing events revealed early phase of apoptosis induced by methylparaben in H1299 human lung carcinoma cells. Arch Toxicol. 2020 Jan;94(1):127-140. doi: 10.1007/s00204-019-02629-w. Epub 2019 Nov 20.
• [30] Glyphosate-based herbicides at low doses affect canonical pathways in estrogen positive and negative breast cancer cell lines. PLoS One. 2019 Jul 11;14(7):e0219610. doi: 10.1371/journal.pone.0219610. eCollection 2019.
• [31] Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.
• [32] Identification of genes targeted by the androgen and PKA signaling pathways in prostate cancer cells. Oncogene. 2006 Nov 23;25(55):7311-23.
• [33] Cancer-related proteins in serum are altered in workers occupationally exposed to polycyclic aromatic hydrocarbons: a cross-sectional study. Carcinogenesis. 2019 Jul 6;40(6):771-781. doi: 10.1093/carcin/bgz022.
• [34] cDNA microarray analysis of isogenic paclitaxel- and doxorubicin-resistant breast tumor cell lines reveals distinct drug-specific genetic signatures of resistance. Breast Cancer Res Treat. 2006 Mar;96(1):17-39. doi: 10.1007/s10549-005-9026-6. Epub 2005 Dec 2.