Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT2CS64Y)

• DOT Name: Carboxypeptidase D (CPD)
• Synonyms: EC 3.4.17.22; Metallocarboxypeptidase D; gp180
• Gene Name: CPD
• Related Disease:
  Advanced cancer
  Bacterial infection
  Breast cancer
  Breast neoplasm
  Ductal breast carcinoma in situ
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lupus
  Neoplasm
  Nicotine dependence
  Anxiety
  Anxiety disorder
  Breast carcinoma
  Chronic renal failure
  End-stage renal disease
  Neuroblastoma
  Prediabetes syndrome
  Prostate cancer
  Prostate carcinoma
  Type-1/2 diabetes
• UniProt ID: CBPD_HUMAN
• PDB ID: 5AQ0
• EC Number: 3.4.17.22
• Pfam ID: PF13620 ; PF00246
• Sequence:
  MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYH
  EEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPD
  AAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLP
  SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRA
  LIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
  IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPAS
  QLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY
  RLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTV
  AIPNILSGTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYV
  MEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
  HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMK
  SYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPC
  KNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQ
  NRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTY
  KITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
  EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLG
  QSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPA
  VTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAII
  ENLIQKQDFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSC
  PNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
  KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNII
  AIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIW
  CICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
• Tissue Specificity: Highly expressed in placenta, pancreas and hepatoma cells. Lower levels found in skeletal muscle, heart and colon carcinoma and melanoma cell lines.
• Reactome Pathway:
  RND3 GTPase cycle (R-HSA-9696264)
  RND1 GTPase cycle (R-HSA-9696273)
  Golgi Associated Vesicle Biogenesis (R-HSA-432722)

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Bacterial infection	DIS5QJ9S	Strong	Genetic Variation	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast neoplasm	DISNGJLM	Strong	Altered Expression	[4]
Ductal breast carcinoma in situ	DISLCJY7	Strong	Altered Expression	[3]
Hepatitis B virus infection	DISLQ2XY	Strong	Altered Expression	[5]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[5]
Lung cancer	DISCM4YA	Strong	Altered Expression	[6]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[6]
Lupus	DISOKJWA	Strong	Biomarker	[7]
Neoplasm	DISZKGEW	Strong	Altered Expression	[6]
Nicotine dependence	DISZD9W7	Strong	Biomarker	[8]
Anxiety	DISIJDBA	Limited	Biomarker	[9]
Anxiety disorder	DISBI2BT	Limited	Biomarker	[9]
Breast carcinoma	DIS2UE88	Limited	Altered Expression	[3]
Chronic renal failure	DISGG7K6	Limited	Genetic Variation	[10]
End-stage renal disease	DISXA7GG	Limited	Genetic Variation	[10]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[11]
Prediabetes syndrome	DISH2I53	Limited	Biomarker	[12]
Prostate cancer	DISF190Y	Limited	Altered Expression	[13]
Prostate carcinoma	DISMJPLE	Limited	Altered Expression	[13]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[12]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Carboxypeptidase D (CPD) affects the response to substance of Fluorouracil.	[34]

This DOT Affected the Biotransformations of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Nitric Oxide	DM1RBYG	Approved	Carboxypeptidase D (CPD) affects the chemical synthesis of Nitric Oxide.	[20]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Carboxypeptidase D (CPD).	[14]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Carboxypeptidase D (CPD).	[15]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Carboxypeptidase D (CPD).	[16]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Carboxypeptidase D (CPD).	[17]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Carboxypeptidase D (CPD).	[18]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Carboxypeptidase D (CPD).	[19]
Testosterone	DM7HUNW	Approved	Testosterone increases the expression of Carboxypeptidase D (CPD).	[20]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Carboxypeptidase D (CPD).	[21]
Selenium	DM25CGV	Approved	Selenium decreases the expression of Carboxypeptidase D (CPD).	[22]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Carboxypeptidase D (CPD).	[23]
Amphotericin B	DMTAJQE	Approved	Amphotericin B decreases the expression of Carboxypeptidase D (CPD).	[24]
Clorgyline	DMCEUJD	Approved	Clorgyline increases the expression of Carboxypeptidase D (CPD).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Carboxypeptidase D (CPD).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Carboxypeptidase D (CPD).	[29]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Carboxypeptidase D (CPD).	[30]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Carboxypeptidase D (CPD).	[31]
chloropicrin	DMSGBQA	Investigative	chloropicrin increases the expression of Carboxypeptidase D (CPD).	[32]
Bilirubin	DMI0V4O	Investigative	Bilirubin decreases the expression of Carboxypeptidase D (CPD).	[33]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Carboxypeptidase D (CPD).	[26]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Carboxypeptidase D (CPD).	[27]

References

• [1] DNA decorated Cu(9)S(5) nanoparticles as NIR light responsive drug carriers for tumor chemo-phototherapy.Dalton Trans. 2018 Jun 19;47(24):7916-7924. doi: 10.1039/c8dt01174e.
• [2] Studies on the interaction between GP-18-0-deficient neutrophils and vascular endothelium.Blood. 1982 Jul;60(1):160-5.
• [3] Prolactin/androgen-inducible carboxypeptidase-D increases with nitrotyrosine and Ki67 for breast cancer progression in vivo, and upregulates progression markers VEGF-C and Runx2 in vitro.Breast Cancer Res Treat. 2017 Jul;164(1):27-40. doi: 10.1007/s10549-017-4223-7. Epub 2017 Mar 31.
• [4] Prolactin and estrogen up-regulate carboxypeptidase-d to promote nitric oxide production and survival of mcf-7 breast cancer cells.Endocrinology. 2008 Oct;149(10):4821-8. doi: 10.1210/en.2008-0145. Epub 2008 Jun 5.
• [5] SiRNA-targeted carboxypeptidase D inhibits hepatocellular carcinoma growth.Cell Biol Int. 2013 Sep;37(9):929-39. doi: 10.1002/cbin.10113. Epub 2013 Apr 30.
• [6] microRNA-214 Governs Lung Cancer Growth and Metastasis by Targeting Carboxypeptidase-D.DNA Cell Biol. 2016 Nov;35(11):715-721. doi: 10.1089/dna.2016.3398. Epub 2016 Aug 5.
• [7] Carboxypeptidase D: a novel TGF-beta target gene dysregulated in patients with lupus erythematosus.J Clin Immunol. 2007 Nov;27(6):568-79. doi: 10.1007/s10875-007-9118-7. Epub 2007 Jul 20.
• [8] Differences in nicotine dependence, smoke exposure and consumer characteristics between smokers of machine-injected roll-your-own cigarettes and factory-made cigarettes.Drug Alcohol Depend. 2018 Jun 1;187:109-115. doi: 10.1016/j.drugalcdep.2018.01.039. Epub 2018 Apr 7.
• [9] The evaluation of a continuing professional development package for primary care dentists designed to reduce stress, build resilience and improve clinical decision-making.Br Dent J. 2017 Aug 25;223(4):261-271. doi: 10.1038/sj.bdj.2017.712.
• [10] Recipient's effects on stored red blood cell performance: the case of uremic plasma.Transfusion. 2019 Jun;59(6):1900-1906. doi: 10.1111/trf.15257. Epub 2019 Mar 19.
• [11] Differential DNA damage response to UV and hydrogen peroxide depending of differentiation stage in a neuroblastoma model.Neurotoxicology. 2012 Oct;33(5):1086-95. doi: 10.1016/j.neuro.2012.05.017. Epub 2012 Jun 9.
• [12] A Mixed-Methods, Randomized Clinical Trial to Examine Feasibility of a Mindfulness-Based Stress Management and Diabetes Risk Reduction Intervention for African Americans with Prediabetes.Evid Based Complement Alternat Med. 2019 Aug 14;2019:3962623. doi: 10.1155/2019/3962623. eCollection 2019.
• [13] Carboxypeptidase-D is elevated in prostate cancer and its anti-apoptotic activity is abolished by combined androgen and prolactin receptor targeting.Prostate. 2014 May;74(7):732-42. doi: 10.1002/pros.22793. Epub 2014 Feb 24.
• [14] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [15] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [16] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [17] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [18] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [19] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [20] Testosterone and prolactin increase carboxypeptidase-D and nitric oxide levels to promote survival of prostate cancer cells. Prostate. 2012 Mar;72(4):450-60.
• [21] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [22] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [23] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [24] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [25] Anti-oncogenic and pro-differentiation effects of clorgyline, a monoamine oxidase A inhibitor, on high grade prostate cancer cells. BMC Med Genomics. 2009 Aug 20;2:55. doi: 10.1186/1755-8794-2-55.
• [26] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [27] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [28] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [29] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [30] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [31] Sulforaphane-induced apoptosis in human leukemia HL-60 cells through extrinsic and intrinsic signal pathways and altering associated genes expression assayed by cDNA microarray. Environ Toxicol. 2017 Jan;32(1):311-328.
• [32] Transcriptomic analysis of human primary bronchial epithelial cells after chloropicrin treatment. Chem Res Toxicol. 2015 Oct 19;28(10):1926-35.
• [33] Global changes in gene regulation demonstrate that unconjugated bilirubin is able to upregulate and activate select components of the endoplasmic reticulum stress response pathway. J Biochem Mol Toxicol. 2010 Mar-Apr;24(2):73-88.
• [34] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [35] Testosterone and prolactin increase carboxypeptidase-D and nitric oxide levels to promote survival of prostate cancer cells. Prostate. 2012 Mar;72(4):450-60.