Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3DKFOU)

DOT Name Fatty acid-binding protein, adipocyte (FABP4)
Synonyms Adipocyte lipid-binding protein; ALBP; Adipocyte-type fatty acid-binding protein; A-FABP; AFABP; Fatty acid-binding protein 4
Gene Name FABP4
Related Disease
Schizophrenia ( )
UniProt ID
FABP4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1TOU ; 1TOW ; 2HNX ; 2NNQ ; 3FR2 ; 3FR4 ; 3FR5 ; 3P6C ; 3P6D ; 3P6E ; 3P6F ; 3P6G ; 3P6H ; 3Q6L ; 3RZY ; 4NNS ; 4NNT ; 5D45 ; 5D47 ; 5D48 ; 5D4A ; 5EDB ; 5EDC ; 5HZ6 ; 5HZ8 ; 5Y0F ; 5Y0G ; 5Y0X ; 5Y12 ; 5Y13 ; 6AYL ; 6LJS ; 6LJT ; 6LJU ; 6LJV ; 6LJW ; 6LJX ; 7FVU ; 7FVV ; 7FVW ; 7FVX ; 7FVY ; 7FVZ ; 7FW0 ; 7FW1 ; 7FW2 ; 7FW3 ; 7FW4 ; 7FW5 ; 7FW6 ; 7FW7 ; 7FW8 ; 7FW9 ; 7FWA ; 7FWB ; 7FWC ; 7FWD ; 7FWE ; 7FWF ; 7FWG ; 7FWH ; 7FWJ ; 7FWK ; 7FWL ; 7FWM ; 7FWN ; 7FWO ; 7FWP ; 7FWQ ; 7FWR ; 7FWS ; 7FWU ; 7FWV ; 7FWW ; 7FWX ; 7FWY ; 7FWZ ; 7FX0 ; 7FX1 ; 7FX2 ; 7FX3 ; 7FX4 ; 7FX5 ; 7FX6 ; 7FX7 ; 7FX8 ; 7FX9 ; 7FXA ; 7FXB ; 7FXC ; 7FXE ; 7FXF ; 7FXG ; 7FXH ; 7FXI ; 7FXJ ; 7FXK ; 7FXL ; 7FXM ; 7FXN ; 7FXP ; 7FXQ ; 7FXR ; 7FXS ; 7FXT ; 7FXU ; 7FXV ; 7FXW ; 7FXX ; 7FXY ; 7FXZ ; 7FY2 ; 7FY3 ; 7FY4 ; 7FY5 ; 7FY6 ; 7FY7 ; 7FY9 ; 7FYB ; 7FYC ; 7FYE ; 7FYF ; 7FYG ; 7FYH ; 7FYI ; 7FYJ ; 7FYK ; 7FYL ; 7FYM ; 7FYO ; 7FYP ; 7FYQ ; 7FYR ; 7FYS ; 7FYT ; 7FYU ; 7FYV ; 7FYX ; 7FYY ; 7FYZ ; 7FZ0 ; 7FZ1 ; 7FZ2 ; 7FZ3 ; 7FZ4 ; 7FZ5 ; 7FZ6 ; 7FZ7 ; 7FZ8 ; 7FZ9 ; 7FZA ; 7FZB ; 7FZC ; 7FZD ; 7FZE ; 7FZF ; 7FZH ; 7FZI ; 7FZJ ; 7FZK ; 7FZL ; 7FZM ; 7FZN ; 7FZO ; 7FZP ; 7FZR ; 7FZS ; 7FZT ; 7FZU ; 7FZV ; 7FZW ; 7FZX ; 7FZY ; 7FZZ ; 7G02 ; 7G03 ; 7G05 ; 7G06 ; 7G07 ; 7G08 ; 7G09 ; 7G0A ; 7G0C ; 7G0F ; 7G0G ; 7G0H ; 7G0I ; 7G0J ; 7G0K ; 7G0L ; 7G0M ; 7G0N ; 7G0O ; 7G0P ; 7G0Q ; 7G0R ; 7G0S ; 7G0T ; 7G0U ; 7G0V ; 7G0X ; 7G0Y ; 7G0Z ; 7G10 ; 7G11 ; 7G12 ; 7G13 ; 7G14 ; 7G15 ; 7G16 ; 7G17 ; 7G18 ; 7G19 ; 7G1A ; 7G1B ; 7G1C ; 7G1D ; 7G1E ; 7G1F ; 7G1G ; 7G1H ; 7G1I ; 7G1J ; 7G1K ; 7G1L ; 7G1M ; 7G1N ; 7G1O ; 7G1P ; 7G1R ; 7G1S ; 7G1T ; 7G1U ; 7G1V ; 7G1W ; 7G1Y ; 7G1Z ; 7G20 ; 7G21 ; 7WC3
Pfam ID
PF00061
Sequence
MCDAFVGTWKLVSSENFDDYMKEVGVGFATRKVAGMAKPNMIISVNGDVITIKSESTFKN
TEISFILGQEFDEVTADDRKVKSTITLDGGVLVHVQKWDGKSTTIKRKREDDKLVVECVM
KGVTSTRVYERA
Function Lipid transport protein in adipocytes. Binds both long chain fatty acids and retinoic acid. Delivers long-chain fatty acids and retinoic acid to their cognate receptors in the nucleus.
KEGG Pathway
PPAR sig.ling pathway (hsa03320 )
Regulation of lipolysis in adipocytes (hsa04923 )
Reactome Pathway
Transcriptional regulation of white adipocyte differentiation (R-HSA-381340 )
Triglyceride catabolism (R-HSA-163560 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Schizophrenia DISSRV2N No Known Unknown [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Fatty acid-binding protein, adipocyte (FABP4). [2]
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Fatty acid-binding protein, adipocyte (FABP4). [8]
------------------------------------------------------------------------------------
48 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [3]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [4]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [6]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [7]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [9]
Phenobarbital DMXZOCG Approved Phenobarbital increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [10]
Dexamethasone DMMWZET Approved Dexamethasone increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [11]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [12]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [14]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
Fenofibrate DMFKXDY Approved Fenofibrate increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [15]
Zidovudine DM4KI7O Approved Zidovudine affects the expression of Fatty acid-binding protein, adipocyte (FABP4). [16]
Capsaicin DMGMF6V Approved Capsaicin decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [17]
Ibuprofen DM8VCBE Approved Ibuprofen decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [18]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
Ursodeoxycholic acid DMCUT21 Approved Ursodeoxycholic acid decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [19]
Rofecoxib DM3P5DA Approved Rofecoxib decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [18]
Bezafibrate DMZDCS0 Approved Bezafibrate increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [15]
Melatonin DMKWFBT Approved Melatonin decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [20]
Ximelegatran DMU8ANS Approved Ximelegatran increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [21]
Hesperetin DMKER83 Approved Hesperetin decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [22]
Valsartan DMREUQ6 Approved Valsartan decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [23]
Dihydrotestosterone DM3S8XC Phase 4 Dihydrotestosterone decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [24]
Berberine DMC5Q8X Phase 4 Berberine decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [25]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [26]
Rigosertib DMOSTXF Phase 3 Rigosertib affects the expression of Fatty acid-binding protein, adipocyte (FABP4). [27]
GSK2816126 DMJDVW4 Phase 1 GSK2816126 decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [28]
KRP-297 DM9VHZC Discontinued in Phase 2 KRP-297 increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [29]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [30]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [31]
3R14S-OCHRATOXIN A DM2KEW6 Investigative 3R14S-OCHRATOXIN A decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [32]
geraniol DMS3CBD Investigative geraniol increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [14]
cinnamaldehyde DMZDUXG Investigative cinnamaldehyde increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [14]
Tributylstannanyl DMHN7CB Investigative Tributylstannanyl increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [33]
GW7647 DM9RD0C Investigative GW7647 increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [34]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative 15-deoxy-Delta(12, 14)-prostaglandin J(2) increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [35]
Farnesol DMV2X1B Investigative Farnesol increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [14]
GW-3965 DMG60ET Investigative GW-3965 increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [34]
BADGE DMCK5DG Investigative BADGE increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [36]
isobutylmethylxanthine DM46F5X Investigative isobutylmethylxanthine increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [37]
T0070907 DMTKSVO Investigative T0070907 decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [38]
L-165041 DMZP7YM Investigative L-165041 increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
Tauroursodeoxycholic acid DMFKRQE Investigative Tauroursodeoxycholic acid decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [19]
5-[2-(4-hydroxyphenyl)ethyl]benzene-1,3-diol DM1KO7U Investigative 5-[2-(4-hydroxyphenyl)ethyl]benzene-1,3-diol decreases the expression of Fatty acid-binding protein, adipocyte (FABP4). [26]
GW-2331 DMM8V9E Investigative GW-2331 increases the expression of Fatty acid-binding protein, adipocyte (FABP4). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 48 Drug(s)

References

1 De novo mutations in schizophrenia implicate synaptic networks. Nature. 2014 Feb 13;506(7487):179-84. doi: 10.1038/nature12929. Epub 2014 Jan 22.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
4 Retinoic acid-induced downmodulation of telomerase activity in human cancer cells. Exp Mol Pathol. 2005 Oct;79(2):108-17.
5 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
6 Copper induces the expression of cholesterogenic genes in human macrophages. Atherosclerosis. 2003 Jul;169(1):71-6.
7 Bisphenol A effects on gene expression in adipocytes from children: association with metabolic disorders. J Mol Endocrinol. 2015 Jun;54(3):289-303.
8 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
9 Cytotoxicity and inhibitory effects of low-concentration triclosan on adipogenic differentiation of human mesenchymal stem cells. Toxicol Appl Pharmacol. 2012 Jul 15;262(2):117-23. doi: 10.1016/j.taap.2012.04.024. Epub 2012 May 1.
10 Dose- and time-dependent effects of phenobarbital on gene expression profiling in human hepatoma HepaRG cells. Toxicol Appl Pharmacol. 2009 Feb 1;234(3):345-60.
11 Dexamethasone and the inflammatory response in explants of human omental adipose tissue. Mol Cell Endocrinol. 2010 Feb 5;315(1-2):292-8.
12 Induction of solid tumor differentiation by the peroxisome proliferator-activated receptor-gamma ligand troglitazone in patients with liposarcoma. Proc Natl Acad Sci U S A. 1999 Mar 30;96(7):3951-6. doi: 10.1073/pnas.96.7.3951.
13 Human adipocyte fatty acid-binding protein (aP2) gene promoter-driven reporter assay discriminates nonlipogenic peroxisome proliferator-activated receptor gamma ligands. J Pharmacol Exp Ther. 2004 Nov;311(2):467-75. doi: 10.1124/jpet.104.068254. Epub 2004 Jul 23.
14 The THP-1 cell toolbox: a new concept integrating the key events of skin sensitization. Arch Toxicol. 2019 Apr;93(4):941-951.
15 Differential effects of peroxisome proliferator-activated receptor activators on the mRNA levels of genes involved in lipid metabolism in primary human monocyte-derived macrophages. Metabolism. 2003 May;52(5):652-7. doi: 10.1053/meta.2003.50100.
16 Adipocyte differentiation, mitochondrial gene expression and fat distribution: differences between zidovudine and tenofovir after 6 months. Antivir Ther. 2009;14(8):1089-100. doi: 10.3851/IMP1457.
17 Induction of the endoplasmic reticulum stress protein GADD153/CHOP by capsaicin in prostate PC-3 cells: a microarray study. Biochem Biophys Res Commun. 2008 Aug 8;372(4):785-91.
18 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
19 Ursodeoxycholic acid but not tauroursodeoxycholic acid inhibits proliferation and differentiation of human subcutaneous adipocytes. PLoS One. 2013 Dec 3;8(12):e82086. doi: 10.1371/journal.pone.0082086. eCollection 2013.
20 Melatonin inhibits adipogenesis and enhances osteogenesis of human mesenchymal stem cells by suppressing PPAR expression and enhancing Runx2 expression. J Pineal Res. 2010 Nov;49(4):364-72. doi: 10.1111/j.1600-079X.2010.00803.x. Epub 2010 Aug 24.
21 Effects of Y-27632 on the osteogenic and adipogenic potential of human dental pulp stem cells in vitro. Hum Exp Toxicol. 2022 Jan-Dec;41:9603271221089003. doi: 10.1177/09603271221089003.
22 Hesperetin inhibit adipocyte differentiation and enhance Bax- and p21-mediated adipolysis in human mesenchymal stem cell adipogenesis. J Biochem Mol Toxicol. 2015 Mar;29(3):99-108. doi: 10.1002/jbt.21672. Epub 2014 Oct 26.
23 Valsartan improves adipose tissue function in humans with impaired glucose metabolism: a randomized placebo-controlled double-blind trial. PLoS One. 2012;7(6):e39930. doi: 10.1371/journal.pone.0039930. Epub 2012 Jun 29.
24 Effects of dihydrotestosterone on differentiation and proliferation of human mesenchymal stem cells and preadipocytes. Mol Cell Endocrinol. 2008 Dec 16;296(1-2):32-40. doi: 10.1016/j.mce.2008.08.019. Epub 2008 Aug 28.
25 Berberine promotes bone marrow-derived mesenchymal stem cells osteogenic differentiation via canonical Wnt/-catenin signaling pathway. Toxicol Lett. 2016 Jan 5;240(1):68-80. doi: 10.1016/j.toxlet.2015.10.007. Epub 2015 Oct 22.
26 Effects of long-term consumption of low doses of resveratrol on diet-induced mild hypercholesterolemia in pigs: a transcriptomic approach to disease prevention. J Nutr Biochem. 2012 Jul;23(7):829-37. doi: 10.1016/j.jnutbio.2011.04.007. Epub 2011 Aug 17.
27 ON 01910.Na is selectively cytotoxic for chronic lymphocytic leukemia cells through a dual mechanism of action involving PI3K/AKT inhibition and induction of oxidative stress. Clin Cancer Res. 2012 Apr 1;18(7):1979-91. doi: 10.1158/1078-0432.CCR-11-2113. Epub 2012 Feb 20.
28 Epigenetic control of skeletal development by the histone methyltransferase Ezh2. J Biol Chem. 2015 Nov 13;290(46):27604-17.
29 Bisphenol-A impairs cellular function and alters DNA methylation of stress pathway genes in first trimester trophoblast cells. Reprod Toxicol. 2018 Dec;82:72-79.
30 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
31 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
32 Ochratoxin A inhibits adipogenesis through the extracellular signal-related kinases-peroxisome proliferator-activated receptor- pathway in human adipose tissue-derived mesenchymal stem cells. Stem Cells Dev. 2011 Mar;20(3):415-26. doi: 10.1089/scd.2010.0071. Epub 2010 Oct 12.
33 Persistent organic pollutants alter DNA methylation during human adipocyte differentiation. Toxicol In Vitro. 2017 Apr;40:79-87. doi: 10.1016/j.tiv.2016.12.011. Epub 2016 Dec 20.
34 System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
35 Peroxisome proliferator-activated receptor gamma ligands stimulate myeloid differentiation and lipogenensis in human leukemia NB4 cells. Dev Growth Differ. 2006 Apr;48(3):177-88. doi: 10.1111/j.1440-169X.2006.00855.x.
36 Bisphenol A diglycidyl ether induces adipogenic differentiation of multipotent stromal stem cells through a peroxisome proliferator-activated receptor gamma-independent mechanism. Environ Health Perspect. 2012 Jul;120(7):984-9. doi: 10.1289/ehp.1205063. Epub 2012 May 25.
37 Aloe-emodin inhibits adipocyte differentiation and maturation during in vitro human mesenchymal stem cell adipogenesis. J Biochem Mol Toxicol. 2012 Aug;26(8):291-300. doi: 10.1002/jbt.21415. Epub 2012 May 29.
38 Effects of Perinatal Exposure to Dibutyltin Chloride on Fat and Glucose Metabolism in Mice, and Molecular Mechanisms, in Vitro. Environ Health Perspect. 2018 May 21;126(5):057006. doi: 10.1289/EHP3030. eCollection 2018 May.