Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT7YUJ9F)

• DOT Name: Fibroblast growth factor 2 (FGF2)
• Synonyms: FGF-2; Basic fibroblast growth factor; bFGF; Heparin-binding growth factor 2; HBGF-2
• Gene Name: FGF2
• UniProt ID: FGF2_HUMAN
• PDB ID: 1BAS; 1BFB; 1BFC; 1BFF; 1BFG; 1BLA; 1BLD; 1CVS; 1EV2; 1FGA; 1FQ9; 1II4; 1IIL; 2BFH; 2FGF; 2M49; 4FGF; 4OEE; 4OEF; 4OEG; 5X1O; 6L4O
• Pfam ID: PF00167
• Sequence:
  MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPRSRAA
  GSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAA
  PAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDG
  RVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERL
  ESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
• Function: Acts as a ligand for FGFR1, FGFR2, FGFR3 and FGFR4. Also acts as an integrin ligand which is required for FGF2 signaling. Binds to integrin ITGAV:ITGB3. Plays an important role in the regulation of cell survival, cell division, cell differentiation and cell migration. Functions as a potent mitogen in vitro. Can induce angiogenesis. Mediates phosphorylation of ERK1/2 and thereby promotes retinal lens fiber differentiation.
• Tissue Specificity: Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
• KEGG Pathway:
  EGFR tyrosine ki.se inhibitor resistance (hsa01521)
  MAPK sig.ling pathway (hsa04010)
  Ras sig.ling pathway (hsa04014)
  Rap1 sig.ling pathway (hsa04015)
  Calcium sig.ling pathway (hsa04020)
  PI3K-Akt sig.ling pathway (hsa04151)
  Sig.ling pathways regulating pluripotency of stem cells (hsa04550)
  Regulation of actin cytoskeleton (hsa04810)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Pathways in cancer (hsa05200)
  Proteoglycans in cancer (hsa05205)
  Chemical carcinogenesis - receptor activation (hsa05207)
  Melanoma (hsa05218)
  Breast cancer (hsa05224)
  Gastric cancer (hsa05226)
• Reactome Pathway:
  (FGFR2)
  (FGFR3)
  (FGFR4)
  PIP3 activates AKT signaling (R-HSA-1257604)
  Signaling by activated point mutants of FGFR1 (R-HSA-1839122)
  Signaling by activated point mutants of FGFR3 (R-HSA-1839130)
  FGFR4 ligand binding and activation (R-HSA-190322)
  FGFR1b ligand binding and activation (R-HSA-190370)
  FGFR3c ligand binding and activation (R-HSA-190372)
  FGFR1c ligand binding and activation (R-HSA-190373)
  FGFR2c ligand binding and activation (R-HSA-190375)
  FGFR2b ligand binding and activation (R-HSA-190377)
  Activated point mutants of FGFR2 (R-HSA-2033519)
  Constitutive Signaling by Aberrant PI3K in Cancer (R-HSA-2219530)
  POU5F1 (OCT4), SOX2, NANOG activate genes related to proliferation (R-HSA-2892247)
  Syndecan interactions (R-HSA-3000170)
  Non-integrin membrane-ECM interactions (R-HSA-3000171)
  Phospholipase C-mediated cascade (R-HSA-5654219)
  Phospholipase C-mediated cascade (R-HSA-5654221)
  Phospholipase C-mediated cascade (R-HSA-5654227)
  Phospholipase C-mediated cascade (R-HSA-5654228)
  Downstream signaling of activated FGFR1 (R-HSA-5654687)
  SHC-mediated cascade (R-HSA-5654688)
  PI-3K cascade (R-HSA-5654689)
  FRS-mediated FGFR1 signaling (R-HSA-5654693)
  PI-3K cascade (R-HSA-5654695)
  SHC-mediated cascade (R-HSA-5654699)
  FRS-mediated FGFR2 signaling (R-HSA-5654700)
  SHC-mediated cascade (R-HSA-5654704)
  FRS-mediated FGFR3 signaling (R-HSA-5654706)
  PI-3K cascade (R-HSA-5654710)
  FRS-mediated FGFR4 signaling (R-HSA-5654712)
  SHC-mediated cascade (R-HSA-5654719)
  PI-3K cascade (R-HSA-5654720)
  Negative regulation of FGFR1 signaling (R-HSA-5654726)
  Negative regulation of FGFR2 signaling (R-HSA-5654727)
  Negative regulation of FGFR3 signaling (R-HSA-5654732)
  Negative regulation of FGFR4 signaling (R-HSA-5654733)
  Signaling by FGFR2 in disease (R-HSA-5655253)
  Signaling by FGFR1 in disease (R-HSA-5655302)
  Signaling by FGFR3 in disease (R-HSA-5655332)
  FGFRL1 modulation of FGFR1 signaling (R-HSA-5658623)
  RAF/MAP kinase cascade (R-HSA-5673001)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  PI5P, PP2A and IER3 Regulate PI3K/AKT Signaling (R-HSA-6811558)
  Signaling by FGFR2 IIIa TM (R-HSA-8851708)
  Formation of intermediate mesoderm (R-HSA-9761174)
  PI3K Cascade (R-HSA-109704)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 7 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Etoposide	DMNH3PG	Approved	Fibroblast growth factor 2 (FGF2) affects the response to substance of Etoposide.	[55]
Paclitaxel	DMLB81S	Approved	Fibroblast growth factor 2 (FGF2) decreases the response to substance of Paclitaxel.	[56]
DTI-015	DMXZRW0	Approved	Fibroblast growth factor 2 (FGF2) decreases the response to substance of DTI-015.	[57]
Topotecan	DMP6G8T	Approved	Fibroblast growth factor 2 (FGF2) affects the response to substance of Topotecan.	[55]
Thalidomide	DM70BU5	Approved	Fibroblast growth factor 2 (FGF2) increases the response to substance of Thalidomide.	[58]
Dobutamine	DMD1B8Z	Approved	Fibroblast growth factor 2 (FGF2) affects the response to substance of Dobutamine.	[59]
Teniposide	DMLW57T	Approved	Fibroblast growth factor 2 (FGF2) decreases the response to substance of Teniposide.	[57]

45 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Fibroblast growth factor 2 (FGF2).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Fibroblast growth factor 2 (FGF2).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Fibroblast growth factor 2 (FGF2).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Fibroblast growth factor 2 (FGF2).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Fibroblast growth factor 2 (FGF2).	[5]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Fibroblast growth factor 2 (FGF2).	[6]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Fibroblast growth factor 2 (FGF2).	[8]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Fibroblast growth factor 2 (FGF2).	[9]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Fibroblast growth factor 2 (FGF2).	[10]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Fibroblast growth factor 2 (FGF2).	[11]
Cannabidiol	DM0659E	Approved	Cannabidiol increases the expression of Fibroblast growth factor 2 (FGF2).	[12]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of Fibroblast growth factor 2 (FGF2).	[13]
Piroxicam	DMTK234	Approved	Piroxicam decreases the expression of Fibroblast growth factor 2 (FGF2).	[15]
Mitomycin	DMH0ZJE	Approved	Mitomycin increases the expression of Fibroblast growth factor 2 (FGF2).	[16]
Cocaine	DMSOX7I	Approved	Cocaine decreases the expression of Fibroblast growth factor 2 (FGF2).	[17]
Simvastatin	DM30SGU	Approved	Simvastatin increases the expression of Fibroblast growth factor 2 (FGF2).	[18]
Gemcitabine	DMSE3I7	Approved	Gemcitabine increases the expression of Fibroblast growth factor 2 (FGF2).	[19]
Sodium phenylbutyrate	DMXLBCQ	Approved	Sodium phenylbutyrate decreases the expression of Fibroblast growth factor 2 (FGF2).	[20]
Dactinomycin	DM2YGNW	Approved	Dactinomycin decreases the expression of Fibroblast growth factor 2 (FGF2).	[21]
Sodium chloride	DMM3950	Approved	Sodium chloride increases the expression of Fibroblast growth factor 2 (FGF2).	[21]
Diazepam	DM08E9O	Approved	Diazepam increases the expression of Fibroblast growth factor 2 (FGF2).	[25]
Lansoprazole	DMXYLQ3	Approved	Lansoprazole decreases the expression of Fibroblast growth factor 2 (FGF2).	[26]
Imiquimod	DM1TMA3	Approved	Imiquimod decreases the expression of Fibroblast growth factor 2 (FGF2).	[27]
Iloprost	DMVPZBE	Approved	Iloprost increases the expression of Fibroblast growth factor 2 (FGF2).	[29]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Fibroblast growth factor 2 (FGF2).	[31]
Beclomethasone dipropionate	DM5NW1E	Phase 4	Beclomethasone dipropionate decreases the activity of Fibroblast growth factor 2 (FGF2).	[32]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Fibroblast growth factor 2 (FGF2).	[34]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the expression of Fibroblast growth factor 2 (FGF2).	[35]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Fibroblast growth factor 2 (FGF2).	[36]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Fibroblast growth factor 2 (FGF2).	[37]
VAL-083	DM9J5Q4	Phase 3	VAL-083 decreases the expression of Fibroblast growth factor 2 (FGF2).	[38]
Gossypol	DMJWE3I	Phase 2	Gossypol decreases the expression of Fibroblast growth factor 2 (FGF2).	[40]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Fibroblast growth factor 2 (FGF2).	[41]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Fibroblast growth factor 2 (FGF2).	[42]
TNP-470	DMT0QK8	Discontinued in Phase 2	TNP-470 decreases the expression of Fibroblast growth factor 2 (FGF2).	[43]
SB 203580	DMAET6F	Terminated	SB 203580 decreases the activity of Fibroblast growth factor 2 (FGF2).	[44]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Fibroblast growth factor 2 (FGF2).	[46]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Fibroblast growth factor 2 (FGF2).	[47]
D-glucose	DMMG2TO	Investigative	D-glucose decreases the expression of Fibroblast growth factor 2 (FGF2).	[49]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Fibroblast growth factor 2 (FGF2).	[50]
CH-223191	DMMJZYC	Investigative	CH-223191 decreases the expression of Fibroblast growth factor 2 (FGF2).	[51]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone increases the expression of Fibroblast growth factor 2 (FGF2).	[52]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Fibroblast growth factor 2 (FGF2).	[53]
Suramin	DMTOUY9	Investigative	Suramin increases the expression of Fibroblast growth factor 2 (FGF2).	[54]
Sucrose	DMVWUCF	Investigative	Sucrose increases the expression of Fibroblast growth factor 2 (FGF2).	[21]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Fibroblast growth factor 2 (FGF2).	[7]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Fibroblast growth factor 2 (FGF2).	[45]

9 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Nicotine	DMWX5CO	Approved	Nicotine increases the secretion of Fibroblast growth factor 2 (FGF2).	[14]
Ardeparin	DMYRX8B	Approved	Ardeparin affects the binding of Fibroblast growth factor 2 (FGF2).	[22]
Morphine	DMRMS0L	Approved	Morphine decreases the secretion of Fibroblast growth factor 2 (FGF2).	[23]
Nifedipine	DMSVOZT	Approved	Nifedipine affects the response to substance of Fibroblast growth factor 2 (FGF2).	[24]
Isradipine	DMA5XGH	Approved	Isradipine increases the secretion of Fibroblast growth factor 2 (FGF2).	[28]
Valdecoxib	DMAY7H4	Approved	Valdecoxib affects the secretion of Fibroblast growth factor 2 (FGF2).	[30]
Chondroitin sulfate	DM0N19Y	Phase 4	Chondroitin sulfate affects the binding of Fibroblast growth factor 2 (FGF2).	[33]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the secretion of Fibroblast growth factor 2 (FGF2).	[39]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the secretion of Fibroblast growth factor 2 (FGF2).	[48]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] Estrogen expands breast cancer stem-like cells through paracrine FGF/Tbx3 signaling. Proc Natl Acad Sci U S A. 2010 Dec 14;107(50):21737-42. doi: 10.1073/pnas.1007863107. Epub 2010 Nov 22.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [9] Chronic occupational exposure to arsenic induces carcinogenic gene signaling networks and neoplastic transformation in human lung epithelial cells. Toxicol Appl Pharmacol. 2012 Jun 1;261(2):204-16.
• [10] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [11] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [12] Cannabidiol Activates Neuronal Precursor Genes in Human Gingival Mesenchymal Stromal Cells. J Cell Biochem. 2017 Jun;118(6):1531-1546. doi: 10.1002/jcb.25815. Epub 2016 Dec 29.
• [13] In vitro and in vivo irinotecan-induced changes in expression profiles of cell cycle and apoptosis-associated genes in acute myeloid leukemia cells. Mol Cancer Ther. 2005 Jun;4(6):885-900.
• [14] Cellular and molecular mechanisms of nicotine's pro-angiogenesis activity and its potential impact on cancer. J Cell Biochem. 2006 Apr 15;97(6):1370-8. doi: 10.1002/jcb.20741.
• [15] Apoptosis induced by piroxicam plus cisplatin combined treatment is triggered by p21 in mesothelioma. PLoS One. 2011;6(8):e23569.
• [16] Effects of mitomycin-C on normal dermal fibroblasts. Laryngoscope. 2006 Apr;116(4):514-7. doi: 10.1097/01.MLG.0000205590.62824.0A.
• [17] Transcriptional profiling in the human prefrontal cortex: evidence for two activational states associated with cocaine abuse. Pharmacogenomics J. 2003;3(1):27-40.
• [18] The role of simvastatin in the osteogenesis of injectable tissue-engineered bone based on human adipose-derived stromal cells and platelet-rich plasma. Biomaterials. 2010 Jul;31(20):5325-35. doi: 10.1016/j.biomaterials.2010.03.037. Epub 2010 Apr 9.
• [19] Metronomic gemcitabine suppresses tumour growth, improves perfusion, and reduces hypoxia in human pancreatic ductal adenocarcinoma. Br J Cancer. 2010 Jun 29;103(1):52-60.
• [20] Gene expression profile analysis of 4-phenylbutyrate treatment of IB3-1 bronchial epithelial cell line demonstrates a major influence on heat-shock proteins. Physiol Genomics. 2004 Jan 15;16(2):204-11.
• [21] Osmotic Induction of Angiogenic Growth Factor Expression in Human Retinal Pigment Epithelial Cells. PLoS One. 2016 Jan 22;11(1):e0147312. doi: 10.1371/journal.pone.0147312. eCollection 2016.
• [22] Basic fibroblast growth factor: lysine 134 is essential for its neuroprotective activity. Neurochem Int. 2007 Jul;51(1):25-31. doi: 10.1016/j.neuint.2007.03.011. Epub 2007 Apr 19.
• [23] Morphine treatment of human monocyte-derived macrophages induces differential miRNA and protein expression: impact on inflammation and oxidative stress in the central nervous system. J Cell Biochem. 2010 Jul 1;110(4):834-45. doi: 10.1002/jcb.22592.
• [24] The effect of basic fibroblast growth factor on cell cycle in human gingival fibroblasts from nifedipine responder and non-responder. J Oral Sci. 2004 Mar;46(1):37-44. doi: 10.2334/josnusd.46.37.
• [25] Patterns of some extracellular matrix gene expression are similar in cells from cleft lip-palate patients and in human palatal fibroblasts exposed to diazepam in culture. Toxicology. 2009 Mar 4;257(1-2):10-6. doi: 10.1016/j.tox.2008.12.002. Epub 2008 Dec 9.
• [26] Effect of chronic duodenal ulceration and its treatment with lanzoprazole or sucralfate on gastroduodenal mucosal protein turnover and TGF-alpha, bFGF, and EGF receptor expression in humans. Dig Dis Sci. 1998 Dec;43(12):2764-70. doi: 10.1023/a:1026680017329.
• [27] Imiquimod: a potential weapon against Dupuytren contracture. Med Hypotheses. 2006;66(5):991-2. doi: 10.1016/j.mehy.2005.09.052. Epub 2005 Dec 20.
• [28] Proliferation of cultured human gingival fibroblasts caused by isradipine, a dihydropyridine-derivative calcium antagonist. Eur J Med Res. 2004 Jun 30;9(6):313-5.
• [29] Prostacyclin receptor up-regulates the expression of angiogenic genes in human endometrium via cross talk with epidermal growth factor Receptor and the extracellular signaling receptor kinase 1/2 pathway. Endocrinology. 2006 Apr;147(4):1697-705. doi: 10.1210/en.2005-1073. Epub 2005 Dec 22.
• [30] The effect of valdecoxib on the production of growth factors evoked by hypoxia and bacterial lipopolysaccharide in HMEC-1 cells. Adv Clin Exp Med. 2013 Nov-Dec;22(6):795-800.
• [31] Dysregulation of leptin and testosterone production and their receptor expression in the human placenta with gestational diabetes mellitus. Placenta. 2010 Jul;31(7):581-8. doi: 10.1016/j.placenta.2010.04.002. Epub 2010 Apr 24.
• [32] Anti-proliferative and anti-remodelling effect of beclomethasone dipropionate, formoterol and salbutamol alone or in combination in primary human bronchial fibroblasts. Allergy. 2008 Apr;63(4):432-7. doi: 10.1111/j.1398-9995.2007.01582.x. Epub 2007 Dec 8.
• [33] Specific molecular interactions of oversulfated chondroitin sulfate E with various heparin-binding growth factors. Implications as a physiological binding partner in the brain and other tissues. J Biol Chem. 2002 Nov 15;277(46):43707-16. doi: 10.1074/jbc.M207105200. Epub 2002 Sep 6.
• [34] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [35] Antimyeloma effects of resveratrol through inhibition of angiogenesis. Chin Med J (Engl). 2007 Oct 5;120(19):1672-7.
• [36] Molecular mechanisms of action of angiopreventive anti-oxidants on endothelial cells: microarray gene expression analyses. Mutat Res. 2005 Dec 11;591(1-2):198-211.
• [37] Cytotoxic effects of curcumin in human retinal pigment epithelial cells. PLoS One. 2013;8(3):e59603. doi: 10.1371/journal.pone.0059603. Epub 2013 Mar 26.
• [38] Dianhydrogalactitol, a potential multitarget agent, inhibits glioblastoma migration, invasion, and angiogenesis. Biomed Pharmacother. 2017 Jul;91:1065-1074. doi: 10.1016/j.biopha.2017.05.025. Epub 2017 May 15.
• [39] Mast cell-fibroblast interactions: human mast cells as source and inducers of fibroblast and epithelial growth factors. J Invest Dermatol. 2002 Mar;118(3):391-5. doi: 10.1046/j.0022-202x.2001.01705.x.
• [40] Combined gossypol and zoledronic acid treatment results in synergistic induction of cell death and regulates angiogenic molecules in ovarian cancer cells. Eur Cytokine Netw. 2009 Sep;20(3):121-30. doi: 10.1684/ecn.2009.0159.
• [41] Benzo[a]pyrene promotes proliferation of human lung cancer cells by accelerating the epidermal growth factor receptor signaling pathway. Cancer Lett. 2009 Jun 8;278(1):27-33. doi: 10.1016/j.canlet.2008.12.017. Epub 2009 Jan 31.
• [42] The BET bromodomain inhibitor JQ1 suppresses growth of pancreatic ductal adenocarcinoma in patient-derived xenograft models. Oncogene. 2016 Feb 18;35(7):833-45.
• [43] Docetaxel enhances the therapeutic effect of the angiogenesis inhibitor TNP-470 (AGM-1470) in metastatic human transitional cell carcinoma. Clin Cancer Res. 2003 Feb;9(2):886-99.
• [44] Contribution of the p38MAPK signalling pathway to proliferation in human cultured airway smooth muscle cells is mitogen-specific. Br J Pharmacol. 2004 Aug;142(7):1182-90. doi: 10.1038/sj.bjp.0705809. Epub 2004 Jul 12.
• [45] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [46] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [47] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [48] Paraquat affects the differentiation of neural stem cells and impairs the function of vascular endothelial cells: a study of molecular mechanism. Environ Toxicol. 2019 Apr;34(4):548-555. doi: 10.1002/tox.22723. Epub 2019 Jan 30.
• [49] Non-nutritional sweeteners effects on endothelial vascular function. Toxicol In Vitro. 2020 Feb;62:104694. doi: 10.1016/j.tiv.2019.104694. Epub 2019 Oct 23.
• [50] Parathyroid hormone regulates the expression of fibroblast growth factor-2 mRNA and fibroblast growth factor receptor mRNA in osteoblastic cells. J Bone Miner Res. 1999 May;14(5):776-83. doi: 10.1359/jbmr.1999.14.5.776.
• [51] The Ah receptor regulates growth factor expression in head and neck squamous cell carcinoma cell lines. Mol Carcinog. 2014 Oct;53(10):765-76.
• [52] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [53] Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
• [54] Increased expression of fibroblast growth factors (FGFs) and their receptor by protamine and suramin on Kaposi's sarcoma-derived cells. Anticancer Res. 1993 Jul-Aug;13(4):887-90.
• [55] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [56] Expression of basic fibroblast growth factor correlates with resistance to paclitaxel in human patient tumors. Pharm Res. 2006 Jun;23(6):1324-31. doi: 10.1007/s11095-006-0136-6. Epub 2006 Jun 8.
• [57] Adenovirus-mediated transfer of siRNA against basic fibroblast growth factor mRNA enhances the sensitivity of glioblastoma cells to chemotherapy. Med Oncol. 2011 Mar;28(1):24-30. doi: 10.1007/s12032-010-9445-z. Epub 2010 Feb 24.
• [58] High plasma basic fibroblast growth factor concentration is associated with response to thalidomide in progressive multiple myeloma. Clin Cancer Res. 2001 Sep;7(9):2675-81.
• [59] Gene therapy in cardiac surgery: intramyocardial injection of naked plasmid DNA for chronic myocardial ischemia. Eur J Cardiothorac Surg. 2003 Nov;24(5):785-93. doi: 10.1016/s1010-7940(03)00455-x.