General Information of Drug Off-Target (DOT) (ID: OTAH8SMF)

DOT Name Fibrocystin (PKHD1)
Synonyms Polycystic kidney and hepatic disease 1 protein; Polyductin; Tigmin
Gene Name PKHD1
Related Disease
Autosomal recessive polycystic kidney disease ( )
Polycystic kidney disease 4 ( )
Adenoma ( )
Advanced cancer ( )
Anal intraepithelial neoplasia ( )
Autosomal dominant polycystic kidney disease ( )
Autosomal dominant polycystic liver disease ( )
Carcinoma ( )
Cardiovascular disease ( )
Cholestasis ( )
Chronic kidney disease ( )
Ciliopathy ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal carcinoma ( )
Common wart ( )
Congestive heart failure ( )
Cystic kidney disease ( )
Episodic kinesigenic dyskinesia 1 ( )
Familial pancreatic carcinoma ( )
Kidney failure ( )
Matthew-Wood syndrome ( )
Medullary sponge kidney ( )
Neoplasm ( )
Pancreatic ductal carcinoma ( )
Schizophrenia ( )
Sexually transmitted infection ( )
Nephronophthisis ( )
Obesity ( )
Caroli disease ( )
Colorectal adenocarcinoma ( )
OPTN-related open angle glaucoma ( )
Acute myelogenous leukaemia ( )
Childhood kidney Wilms tumor ( )
Familial adenomatous polyposis ( )
Familial prostate carcinoma ( )
High blood pressure ( )
Pneumocystis pneumonia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Wilms tumor ( )
UniProt ID
PKHD1_HUMAN
Pfam ID
PF13229 ; PF10162 ; PF01833
Sequence
MTAWLISLMSIEVLLLAVRHLSLHIEPEEGSLAGGTWITVIFDGLELGVLYPNNGSQLEI
HLVNVNMVVPALRSVPCDVFPVFLDLPVVTCRTRSVLSEAHEGLYFLEAYFGGQLVSSPN
PGPRDSCTFKFSKAQTPIVHQVYPPSGVPGKLIHVYGWIITGRLETFDFDAEYIDSPVIL
EAQGDKWVTPCSLINRQMGSCYPIQEDHGLGTLQCHVEGDYIGSQNVSFSVFNKGKSMVH
KKAWLISAKQDLFLYQTHSEILSVFPETGSLGGRTNITITGDFFDNSAQVTIAGIPCDIR
HVSPRKIECTTRAPGKDVRLTTPQPGNRGLLFEVGDAVEGLELTEATPGYRWQIVPNASS
PFGFWSQEGQPFRARLSGFFVAPETNNYTFWIQADSQASLHFSWSEEPRTKVKVASISVG
TADWFDSWEQNRDEGTWQQKTPKLELLGGAMYYLEAEHHGIAPSRGMRIGVQIHNTWLNP
DVVTTYLREKHQIRVRAQRLPEVQVLNVSGRGNFFLTWDNVSSQPIPANATAHLIQTTIE
ELLAVKCKLEPLWSNILLRLGFERGPEVSNSDGDLTSGTEPFCGRFSLRQPRHLVLTPPA
AQKGYRLDQYTHLCLAYKGHMNKILKMIVSFTIGFQNMVKNTTCDWSLTRTSPESWQFDC
TDLWETCVRCFGDLQPPPANSPVLVHQINLLPLAQETGLFYVDEIIIADTNVTVSQADSG
TARPGGNLVESVSVVGSPPVYSVTSWLAGCGTELPLITARSVPTEGTEEGSGLVLVTTQR
RQRTSPPLGGHFRIQLPNTVISDVPVQISAHHLHQLLQNNADDFTSRYLNASDFTVKEDL
YTCYEHVWTLSWSTQIGDLPNFIRVSDENLTGVNPAAATRVVYDGGVFLGPIFGDMLATA
NQHTQVVVRVNDVPAHCPGSCSFQYLQGSTPCVHSVWYSIDGDINLMIYITGTGFSGDSQ
FLQVTVNKTSCKVIFSNQTNVVCQTDLLPVGMHRILMLVRPSGLAISATGEDLFLNVKPR
LDMVEPSRAADIGGLWATIRGSSLEGVSLILFGSYSCAINVATSNSSRIQCKVPPRGKDG
RIVNVTVIRGDYSAVLPRAFTYVSSLNPVIVTLSRNISNIAGGETLVIGVARLMNYTDLD
VEVHVQDALAPVHTQSAWGLEVALPPLPAGLHRISVSINGVSIHSQGVDLHIQYLTEVFS
IEPCCGSLLGGTILSISGIGFSRDPALVWVLVGNRSCDIVNLTEASIWCETLPAPQIPDA
GAPTVPAAVEVWAGNRFFARGPSPSLVGKGFTFMYEAAATPVVTAMQGEITNSSLSLHVG
GSNLSNSVILLGNLNCDVETQSFQGNVSLSGCSIPLHSLEAGIYPLQVRQKQMGFANMSV
VLQQFAVMPRIMAIFPSQGSACGGTILTVRGLLLNSRRRSVRVDLSGPFTCVILSLGDHT
ILCQVSLEGDPLPGASFSLNVTVLVNGLTSECQGNCTLFIREEASPVMDALSTNTSGSLT
TVLIRGQRLATTADEPMVFVDDQLPCNVTFFNASHVVCQTRDLAPGPHYLSVFYTRNGYA
CSGNVSRHFYIMPQVFHYFPKNFSLHGGSLLTIEGTGLRGQNTTSVYIDQQTCLTVNIGA
ELIRCIVPTGNGSVALEIEVDGLWYHIGVIGYNKAFTPELISISQSDDILTFAVAQISGA
ANIDIFIGMSPCVGVSGNHTVLQCVVPSLPAGEYHVRGYDCIRGWASSALVFTSRVIITA
VTENFGCLGGRLVHVFGAGFSPGNVSAAVCGAPCRVLANATVSAFSCLVLPLDVSLAFLC
GLKREEDSCEAARHTYVQCDLTVAMATEQLLESWPYLYICEESSQCLFVPDHWAESMFPS
FSGLFISPKLERDEVLIYNSSCNITMETEAEMECETPNQPITVKITEIRKRWGQNTQGNF
SLQFCRRWSRTHSWFPERLPQDGDNVTVENGQLLLLDTNTSILNLLHIKGGKLIFMAPGP
IELRAHAILVSDGGELRIGSEDKPFQGRAQITLYGSSYSTPFFPYGVKFLAVRNGTLSLH
GSLPEVIVTCLRATAHALDTVLALEDAVDWNPGDEVVIISGTGVKGAKPMEEIVTVETVQ
DTDLYLKSPLRYSHNFTENWVAGEHHILKATVALLSRSITIQGNLTNEREKLLVSCQEAN
APEGNLQHCLYSMSEKMLGSRDMGARVIVQSFPEEPSQVQLKGVQFQVLGQAFHKHLSSL
TLVGAMRESFIQGCTVRNSFSRGLSMCGTLGLKVDSNVFYNILGHALLVGTCTEMRYISW
EAIHGRKDDWSGHGNIIRNNVIIQVSGAEGLSNPEMLTPSGIYICSPTNVIEGNRVCGAG
YGYFFHLMTNQTSQAPLLSFTQNIAHSCTRYGLFVYPKFQPPWDNVTGTTLFQSFTVWES
AGGAQIFRSSNLRLKNFKVYSCRDFGIDVLESDANTSVTDSLLLGHFAHKGSLCMSSGIK
TPKRWELMVSNTTFVNFDLINCVAIRTCSDCSQGQGGFTVKTSQLKFTNSSNLVAFPFPH
AAILEDLDGSLSGKNRSHILASMETLSASCLVNSSFGRVVHGSACGGGVLFHRMSIGLAN
TPEVSYDLTMTDSRNKTTTVNYVRDTLSNPRGWMALLLDQETYSLQSENLWINRSLQYSA
TFDNFAPGNYLLLVHTDLPPYPDILLRCGSRVGLSFPFLPSPGQNQGCDWFFNSQLRQLT
YLVSGEGQVQVILRVKEGMPPTISASTSAPESALKWSLPETWQGVEEGWGGYNNTIPGPG
DDVLILPNRTVLVDTDLPFFKGLYVMGTLDFPVDRSNVLSVACMVIAGGELKVGTLENPL
EKEQKLLILLRASEGVFCDRMNGIHIDPGTIGVYGKVHLYSAYPKNSWTHLGADIASGNE
RIIVEDAVDWRPHDKIVLSSSSYEPHEAEVLTVKEVKGHHVRIYERLKHRHIGSVHVTED
GRHIRLAAEVGLLTRNIQIQPDVSCRGRLFVGSFRKSSREEFSGVLQLLNVEIQNFGSPL
YSSVEFSNVSAGSWIISSTLHQSCGGGIHAAASHGVLLNDNIVFGTAGHGIDLEGQAYTV
TNNLVVLMTQPAWSTIWVAGIKVNQVKDINLHGNVVAGSERLGFHIRGHKCSSCELLWSD
NVAHSSLHGLHLYKESGLDNCTRISGFLAFKNFDYGAMLHVENSVEIENITLVDNTIGLL
AVVYVFSAPQNSVKKVQIVLRNSVIVATSSSFDCIQDKVKPHSANLTSTDRAPSNPRGGR
IGILWPVFTSEPNQWPQEPWHKVRNDHSISGIMKLQDVTFSSFVKSCYSDDLDVCILPNA
ENSGIMHPITAERTRMLKIKDKNKFYFPSLQPRKDLGKVVCPELDCASPRKYLFKDLDGR
ALGLPPPVSVFPKTEAEWTASFFNAGTFREEQKCTYQFLMQGFICKQTDQVVLILDSADA
IWAIQKLYPVVSVTSGFVDVFSSVNANIPCSTSGSVSTFYSILPIRQITKVCFMDQTPQV
LRFFLLGNKSTSKLLLAVFYHELQSPHVFLGESFIPPTLVQSASLLLNESIGANYFNIMD
NLLYVVLQGEEPIEIRSGVSIHLALTVMVSVLEKGWEIVILERLTNFLQIGQNQIRFIHE
MPGHEETLKAIADSRAKRKRNCPTVTCTSHYRRVGQRRPLMMEMNSHRASPPMTVETISK
VIVIEIGDSPTVRSTGMISSLSSNKLQNLAHRVITAQQTGVLENVLNMTIGALLVTQSKG
VIGYGNTSSFKTGNLIYIRPYALSILVQPSDGEVGNELPVQPQLVFLDEQNRRVESLGPP
SEPWTISASLEGASDSVLKGCTQAETQDGYVSFYNLAVLISGSNWHFIFTVTSPPGVNFT
ARSKPFAVLPVTRKEKSTIILAASLSSVASWLALSCLVCCWLKRSKSRKTKPEEIPESQT
NNQNIHIHISSKRRESQGPKKEDTVVGEDMRMKVMLGKVNQCPHQLMNGVSRRKVSRHIV
REEEAAVPAPGTTGITSHGHICAPGAPAQQVYLQETGNWKEGQEQLLRYQLAGQNQLLLL
CPDFRQERQQLPGQSRLSKQSGSLGLSQEKKASCGATEAFCLHSVHPETIQEQL
Function
Promotes ciliogenesis in renal epithelial cells and therefore participates in the tubules formation and/ or ensures the maintenance of the architecture of the lumen of the kidney. Has an impact on cellular symmetry by ensuring correct bipolar cell division through the regulation of centrosome duplication and mitotic spindle assembly and by maintaining oriented cell division (OCD) during tubular elongation through planar cell polarity (PCP) pathway. During epithelial cell morphogenesis regulates also cell-cell and cell-matrix adhesion and participates in cell motility. Promotes cell-cell contact through the positive regulation of PTK2 kinase activity leading to either positive regulation of epithelial cell proliferation through the HRAS/RAF1 pathways, or negative regulation of apoptosis through the PDK1/AKT1 pathway. May act in collecting-duct and biliary differentiation. May participate in the regulation of the cholangiocytes proliferation and the CCN2 production in an CXCL8-dependent manner.
Tissue Specificity
Predominantly expressed in fetal and adult kidney. In the kidney, it is found in the cortical and medullary collecting ducts. Also present in the adult pancreas, but at much lower levels. Detectable in fetal and adult liver. Rather indistinct signal in fetal brain.

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autosomal recessive polycystic kidney disease DISPUS40 Definitive Autosomal recessive [1]
Polycystic kidney disease 4 DISNSG52 Definitive Autosomal recessive [2]
Adenoma DIS78ZEV Strong Biomarker [3]
Advanced cancer DISAT1Z9 Strong Biomarker [4]
Anal intraepithelial neoplasia DISJ0JW3 Strong Genetic Variation [5]
Autosomal dominant polycystic kidney disease DISBHWUI Strong Biomarker [6]
Autosomal dominant polycystic liver disease DISJS005 Strong Genetic Variation [7]
Carcinoma DISH9F1N Strong Genetic Variation [8]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [9]
Cholestasis DISDJJWE Strong Genetic Variation [10]
Chronic kidney disease DISW82R7 Strong Biomarker [11]
Ciliopathy DIS10G4I Strong Biomarker [6]
Colon cancer DISVC52G Strong Genetic Variation [12]
Colon carcinoma DISJYKUO Strong Genetic Variation [12]
Colorectal carcinoma DIS5PYL0 Strong Genetic Variation [13]
Common wart DISPREJ5 Strong Biomarker [14]
Congestive heart failure DIS32MEA Strong Biomarker [15]
Cystic kidney disease DISRT1LM Strong Genetic Variation [6]
Episodic kinesigenic dyskinesia 1 DISGVQMP Strong Genetic Variation [16]
Familial pancreatic carcinoma DIS1XROR Strong Biomarker [17]
Kidney failure DISOVQ9P Strong Genetic Variation [18]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [17]
Medullary sponge kidney DISA0949 Strong Genetic Variation [7]
Neoplasm DISZKGEW Strong Genetic Variation [5]
Pancreatic ductal carcinoma DIS26F9Q Strong Genetic Variation [17]
Schizophrenia DISSRV2N Strong Biomarker [19]
Sexually transmitted infection DISIVIAL Strong Biomarker [14]
Nephronophthisis DISXU4HY moderate CausalMutation [20]
Obesity DIS47Y1K moderate Genetic Variation [21]
Caroli disease DISXQYMX Supportive Autosomal recessive [22]
Colorectal adenocarcinoma DISPQOUB Disputed Biomarker [13]
OPTN-related open angle glaucoma DISDR98A Disputed Genetic Variation [23]
Acute myelogenous leukaemia DISCSPTN Limited Genetic Variation [24]
Childhood kidney Wilms tumor DIS0NMK3 Limited Genetic Variation [25]
Familial adenomatous polyposis DISW53RE Limited Biomarker [26]
Familial prostate carcinoma DISL9KNO Limited Genetic Variation [27]
High blood pressure DISY2OHH Limited Genetic Variation [28]
Pneumocystis pneumonia DISFSOM3 Limited Altered Expression [29]
Prostate cancer DISF190Y Limited Biomarker [27]
Prostate carcinoma DISMJPLE Limited Biomarker [27]
Wilms tumor DISB6T16 Limited Genetic Variation [25]
------------------------------------------------------------------------------------
⏷ Show the Full List of 41 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Fibrocystin (PKHD1). [30]
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Fibrocystin (PKHD1). [31]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Fibrocystin (PKHD1). [32]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Fibrocystin (PKHD1). [33]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Fibrocystin (PKHD1). [35]
PMID28870136-Compound-48 DMPIM9L Patented PMID28870136-Compound-48 decreases the expression of Fibrocystin (PKHD1). [36]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Fibrocystin (PKHD1). [34]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Fibrocystin (PKHD1). [37]
------------------------------------------------------------------------------------

References

1 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
2 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
3 Pathogenesis of polyps (adenomas).Dis Colon Rectum. 1983 Jun;26(6):413-4. doi: 10.1007/BF02553387.
4 Periampullary malignancy in Gardner's syndrome.Ann Surg. 1977 May;185(5):565-73. doi: 10.1097/00000658-197705000-00009.
5 Benefit of Surveillance for Pancreatic Cancer in High-Risk Individuals: Outcome of Long-Term Prospective Follow-Up Studies From Three European Expert Centers.J Clin Oncol. 2016 Jun 10;34(17):2010-9. doi: 10.1200/JCO.2015.64.0730. Epub 2016 Apr 25.
6 Imaging of Kidney Cysts and Cystic Kidney Diseases in Children: An International Working Group Consensus Statement.Radiology. 2019 Mar;290(3):769-782. doi: 10.1148/radiol.2018181243. Epub 2019 Jan 1.
7 Heterozygous Pkhd1(C642*) mice develop cystic liver disease and proximal tubule ectasia that mimics radiographic signs of medullary sponge kidney.Am J Physiol Renal Physiol. 2019 Mar 1;316(3):F463-F472. doi: 10.1152/ajprenal.00181.2018. Epub 2019 Jan 2.
8 Loss of constitutional heterozygosity in colon carcinoma from patients with familial polyposis coli.Nature. 1988 Jan 21;331(6153):273-7. doi: 10.1038/331273a0.
9 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
10 Taking the next step forward - Diagnosing inherited infantile cholestatic disorders with next generation sequencing.Mol Cell Probes. 2015 Oct;29(5):291-8. doi: 10.1016/j.mcp.2015.03.001. Epub 2015 Mar 13.
11 Abnormalities in focal adhesion complex formation, regulation, and function in human autosomal recessive polycystic kidney disease epithelial cells.Am J Physiol Cell Physiol. 2010 Apr;298(4):C831-46. doi: 10.1152/ajpcell.00032.2009. Epub 2009 Nov 18.
12 Multistage risk models and the age pattern in familial polyposis coli.Cancer Invest. 1984;2(6):443-8. doi: 10.3109/07357908409048517.
13 Germline PKHD1 mutations are protective against colorectal cancer.Hum Genet. 2011 Mar;129(3):345-9. doi: 10.1007/s00439-011-0950-8. Epub 2011 Jan 28.
14 Screening for wart virus infection in normal and abnormal cervices by DNA hybridisation of cervical scrapes.Lancet. 1985 Jan 12;1(8420):65-7. doi: 10.1016/s0140-6736(85)91963-4.
15 Loss of fibrocystin promotes interleukin-8-dependent proliferation and CTGF production of biliary epithelium.J Hepatol. 2019 Jul;71(1):143-152. doi: 10.1016/j.jhep.2019.02.024. Epub 2019 Mar 19.
16 Proliferative signaling by ERBB proteins and RAF/MEK/ERK effectors in polycystic kidney disease.Cell Signal. 2020 Mar;67:109497. doi: 10.1016/j.cellsig.2019.109497. Epub 2019 Dec 9.
17 Prevalence and Progression of Pancreatic Cystic Precursor Lesions Differ Between Groups at High Risk of Developing Pancreatic Cancer.Pancreas. 2017 Jan;46(1):28-34. doi: 10.1097/MPA.0000000000000725.
18 Mutation of hepatocyte nuclear factor-1beta inhibits Pkhd1 gene expression and produces renal cysts in mice.J Clin Invest. 2004 Mar;113(6):814-25. doi: 10.1172/JCI20083.
19 Association between social functioning and prefrontal cortex function during a verbal fluency task in schizophrenia: A near-infrared spectroscopic study.Psychiatry Clin Neurosci. 2017 Nov;71(11):769-779. doi: 10.1111/pcn.12548. Epub 2017 Jul 31.
20 PKHD1 sequence variations in 78 children and adults with autosomal recessive polycystic kidney disease and congenital hepatic fibrosis. Mol Genet Metab. 2010 Feb;99(2):160-73. doi: 10.1016/j.ymgme.2009.10.010. Epub 2009 Oct 20.
21 Genetic architecture of human thinness compared to severe obesity.PLoS Genet. 2019 Jan 24;15(1):e1007603. doi: 10.1371/journal.pgen.1007603. eCollection 2019 Jan.
22 Whole exome sequencing identifies recessive PKHD1 mutations in a Chinese twin family with Caroli disease. PLoS One. 2014 Apr 7;9(4):e92661. doi: 10.1371/journal.pone.0092661. eCollection 2014.
23 Family-based analysis identified CD2 as a susceptibility gene for primary open angle glaucoma in Chinese Han population.J Cell Mol Med. 2014 Apr;18(4):600-9. doi: 10.1111/jcmm.12201. Epub 2014 Mar 6.
24 Genome-wide haplotype association study identify the FGFR2 gene as a risk gene for acute myeloid leukemia.Oncotarget. 2017 Jan 31;8(5):7891-7899. doi: 10.18632/oncotarget.13631.
25 Concerted nonsyntenic allelic loss in human colorectal carcinoma.Science. 1988 Aug 19;241(4868):961-5. doi: 10.1126/science.2841761.
26 Familial and sporadic pancreatic cancer share the same molecular pathogenesis.Fam Cancer. 2015 Mar;14(1):95-103. doi: 10.1007/s10689-014-9755-y.
27 A systematic review of replication studies of prostate cancer susceptibility genetic variants in high-risk men originally identified from genome-wide association studies.Cancer Epidemiol Biomarkers Prev. 2011 Aug;20(8):1599-610. doi: 10.1158/1055-9965.EPI-11-0312. Epub 2011 Jun 29.
28 Comprehensive genetic testing in children with a clinical diagnosis of ARPKD identifies phenocopies.Pediatr Nephrol. 2018 Oct;33(10):1713-1721. doi: 10.1007/s00467-018-3992-5. Epub 2018 Jun 28.
29 Atmin modulates Pkhd1 expression and may mediate Autosomal Recessive Polycystic Kidney Disease (ARPKD) through altered non-canonical Wnt/Planar Cell Polarity (PCP) signalling.Biochim Biophys Acta Mol Basis Dis. 2019 Feb 1;1865(2):378-390. doi: 10.1016/j.bbadis.2018.11.003. Epub 2018 Nov 7.
30 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
31 Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
32 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
33 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
34 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
35 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
36 Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
37 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.