Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTC9GZ2M)

DOT Name	Calcyphosin (CAPS)
Synonyms	Calcyphosine
Gene Name	CAPS
Related Disease	Prostate cancer ( ) Prostate carcinoma ( ) Autosomal dominant familial periodic fever ( ) Behcet disease ( ) Beta-thalassemia major ( ) Carcinoma ( ) Cardiac arrest ( ) Colorectal carcinoma ( ) Cryopyrin-associated periodic syndrome ( ) Depression ( ) Esophageal squamous cell carcinoma ( ) leukaemia ( ) Lung adenocarcinoma ( ) Majeed syndrome ( ) Malignant mesothelioma ( ) Mixed anxiety and depressive disorder ( ) Vasculitis ( ) Ependymoma ( ) Neoplasm ( ) Primitive neuroectodermal tumor ( ) Autoimmune polyendocrinopathy ( ) Mental disorder ( ) Periodic fever syndrome ( ) Post-traumatic stress disorder ( ) Type-1/2 diabetes ( ) Urticaria ( )
UniProt ID	CAYP1_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3E3R
Pfam ID	PF13499
Sequence	MQCHRDLALSQALWGWQLSKQSGWAHPSLPHSPLPSTVHSCSWAPPHLQRHLPLATVSPG TTQLTQGPAGRTLGQTQASCPEPRPSMDAVDATMEKLRAQCLSRGASGIQGLARFFRQLD RDGSRSLDADEFRQGLAKLGLVLDQAEAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAR EAVIAAAFAKLDRSGDGVVTVDDLRGVYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKD GQVTLAEFQDYYSGVSASMNTDEEFVAMMTSAWQL
Function	Calcium-binding protein. May play a role in cellular signaling events (Potential).

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Prostate cancer	DISF190Y	Definitive	Genetic Variation	[1]
Prostate carcinoma	DISMJPLE	Definitive	Genetic Variation	[1]
Autosomal dominant familial periodic fever	DISCRNV1	Strong	Biomarker	[2]
Behcet disease	DISSYMBS	Strong	Biomarker	[3]
Beta-thalassemia major	DISW06BV	Strong	Biomarker	[4]
Carcinoma	DISH9F1N	Strong	Biomarker	[5]
Cardiac arrest	DIS9DIA4	Strong	Genetic Variation	[6]
Colorectal carcinoma	DIS5PYL0	Strong	Biomarker	[7]
Cryopyrin-associated periodic syndrome	DISPXXOZ	Strong	Biomarker	[8]
Depression	DIS3XJ69	Strong	Biomarker	[9]
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Biomarker	[5]
leukaemia	DISS7D1V	Strong	Biomarker	[10]
Lung adenocarcinoma	DISD51WR	Strong	Altered Expression	[11]
Majeed syndrome	DIS8AI2U	Strong	Biomarker	[12]
Malignant mesothelioma	DISTHJGH	Strong	Biomarker	[13]
Mixed anxiety and depressive disorder	DISV809X	Strong	Genetic Variation	[14]
Vasculitis	DISQRKDX	Strong	Biomarker	[15]
Ependymoma	DISUMRNZ	moderate	Biomarker	[16]
Neoplasm	DISZKGEW	moderate	Biomarker	[16]
Primitive neuroectodermal tumor	DISFHXHA	moderate	Biomarker	[16]
Autoimmune polyendocrinopathy	DISOLDB2	Limited	Genetic Variation	[17]
Mental disorder	DIS3J5R8	Limited	Genetic Variation	[18]
Periodic fever syndrome	DIS9MNYC	Limited	Biomarker	[8]
Post-traumatic stress disorder	DISHL1EY	Limited	Biomarker	[19]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[20]
Urticaria	DIS9WQAI	Limited	Altered Expression	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 26 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Calcyphosin (CAPS).	[21]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Calcyphosin (CAPS).	[30]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Calcyphosin (CAPS).	[32]
------------------------------------------------------------------------------------

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Calcyphosin (CAPS).	[22]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Calcyphosin (CAPS).	[23]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Calcyphosin (CAPS).	[24]
Temozolomide	DMKECZD	Approved	Temozolomide increases the expression of Calcyphosin (CAPS).	[25]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Calcyphosin (CAPS).	[26]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Calcyphosin (CAPS).	[27]
Ethinyl estradiol	DMODJ40	Approved	Ethinyl estradiol increases the expression of Calcyphosin (CAPS).	[28]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Calcyphosin (CAPS).	[29]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Calcyphosin (CAPS).	[31]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Calcyphosin (CAPS).	[33]
Paraquat	DMR8O3X	Investigative	Paraquat decreases the expression of Calcyphosin (CAPS).	[34]
------------------------------------------------------------------------------------


⏷ Show the Full List of 11 Drug(s)

References

1	A population-based assessment of germline HOXB13 G84E mutation and prostate cancer risk.Eur Urol. 2014 Jan;65(1):169-76. doi: 10.1016/j.eururo.2012.07.027. Epub 2012 Jul 20.
2	Identifying mutations in autoinflammatory diseases: towards novel genetic tests and therapies?.Am J Pharmacogenomics. 2004;4(2):109-18. doi: 10.2165/00129785-200404020-00005.
3	Autoinflammatory syndromes.Clin Exp Rheumatol. 2006 Jan-Feb;24(1 Suppl 40):S79-85.
4	Effect of serum fibroblast growth factor receptor 2 and CAPS proteins on calcium status in -thalassaemia major patients who are free from overt inflammation.Growth Factors. 2018 Aug;36(3-4):178-185. doi: 10.1080/08977194.2018.1520707. Epub 2018 Oct 30.
5	Overexpression of calcyphosine is associated with poor prognosis in esophageal squamous cell carcinoma.Oncol Lett. 2017 Nov;14(5):6231-6237. doi: 10.3892/ol.2017.6973. Epub 2017 Sep 15.
6	The CAPS Study: incidence, management and outcomes of cardiac arrest in pregnancy in the UK: a prospective, descriptive study.BJOG. 2017 Aug;124(9):1374-1381. doi: 10.1111/1471-0528.14521. Epub 2017 Feb 24.
7	CAPS1 promotes colorectal cancer metastasis via Snail mediated epithelial mesenchymal transformation.Oncogene. 2019 Jun;38(23):4574-4589. doi: 10.1038/s41388-019-0740-7. Epub 2019 Feb 11.
8	Guidelines for the management and treatment of periodic fever syndromes: Cryopyrin-associated periodic syndromes (cryopyrinopathies - CAPS).Rev Bras Reumatol Engl Ed. 2016 Jan-Feb;56(1):44-51. doi: 10.1016/j.rbre.2015.08.020. Epub 2015 Oct 20.
9	Posttraumatic stress disorder, depression, and suicidal ideation in veterans: Results from the mind your heart study.Psychiatry Res. 2018 Jul;265:224-230. doi: 10.1016/j.psychres.2018.04.046. Epub 2018 Apr 22.
10	The sensitivity of reported effects of EMF on childhood leukemia to uncontrolled confounding by residential mobility: a hybrid simulation study and an empirical analysis using CAPS data.Cancer Causes Control. 2019 Aug;30(8):901-908. doi: 10.1007/s10552-019-01189-9. Epub 2019 May 29.
11	Differentially expressed and survival-related proteins of lung adenocarcinoma with bone metastasis.Cancer Med. 2018 Apr;7(4):1081-1092. doi: 10.1002/cam4.1363. Epub 2018 Mar 9.
12	Pattern and diagnostic evaluation of systemic autoinflammatory diseases other than familial Mediterranean fever among Arab children: a multicenter study from the Pediatric Rheumatology Arab Group (PRAG).Rheumatol Int. 2020 Jan;40(1):49-56. doi: 10.1007/s00296-019-04478-3. Epub 2019 Nov 18.
13	The role of apoptosis defects in malignant mesothelioma pathogenesis with an impact on prognosis and treatment.Cancer Chemother Pharmacol. 2019 Aug;84(2):241-253. doi: 10.1007/s00280-019-03878-3. Epub 2019 May 22.
14	Screening for trauma-related symptoms via a smartphone app: The validity of Smart Assessment on your Mobile in referred police officers.Int J Methods Psychiatr Res. 2017 Sep;26(3):e1579. doi: 10.1002/mpr.1579.
15	Clinical, imaging and genotypical features of three deceased and five surviving cases with ADA2 deficiency.Rheumatol Int. 2018 Jan;38(1):129-136. doi: 10.1007/s00296-017-3740-3. Epub 2017 May 17.
16	Identification of novel biomarkers in pediatric primitive neuroectodermal tumors and ependymomas by proteome-wide analysis.J Neuropathol Exp Neurol. 2007 Jun;66(6):505-16. doi: 10.1097/01.jnen.0000240475.35414.c3.
17	Complement activity and complement regulatory gene mutations are associated with thrombosis in APS and CAPS.Blood. 2020 Jan 23;135(4):239-251. doi: 10.1182/blood.2019003863.
18	Establishing Concurrent Validity for a Brief PTSD Screen Among Women in a Domestic Violence Shelter.J Interpers Violence. 2021 Apr;36(7-8):NP3646-NP3660. doi: 10.1177/0886260518779595. Epub 2018 Jun 17.
19	Health-economic benefits of treating trauma in psychosis.Eur J Psychotraumatol. 2019 Jan 21;10(1):1565032. doi: 10.1080/20008198.2018.1565032. eCollection 2019.
20	Effects of Chronic Administration of Capsaicin on Biomarkers of Kidney Injury in Male Wistar Rats with Experimental Diabetes.Molecules. 2018 Dec 21;24(1):36. doi: 10.3390/molecules24010036.
21	Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
22	Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
23	Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
24	17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
25	Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
26	Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
27	Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
28	The genomic response of a human uterine endometrial adenocarcinoma cell line to 17alpha-ethynyl estradiol. Toxicol Sci. 2009 Jan;107(1):40-55.
29	Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
30	Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
31	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
32	DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
33	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
34	An in vitro strategy using multiple human induced pluripotent stem cell-derived models to assess the toxicity of chemicals: A case study on paraquat. Toxicol In Vitro. 2022 Jun;81:105333. doi: 10.1016/j.tiv.2022.105333. Epub 2022 Feb 16.