Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFJKMO4)

• DOT Name: Synaptophysin (SYP)
• Synonyms: Major synaptic vesicle protein p38
• Gene Name: SYP
• Related Disease:
  Epilepsy
  Intellectual disability, X-linked 96
  Adenocarcinoma
  Adenoma
  Advanced cancer
  Amyloidosis
  Breast cancer
  Breast carcinoma
  Carcinoid tumor
  Carcinoma
  Cognitive impairment
  Colorectal carcinoma
  Depression
  Endometriosis
  Glioma
  Hepatocellular carcinoma
  Intellectual disability
  Intellectual disability, X-linked 1
  Major depressive disorder
  Matthew-Wood syndrome
  Medullary thyroid gland carcinoma
  Medulloblastoma
  Metastatic malignant neoplasm
  Non-small-cell lung cancer
  Paraganglioma
  Pheochromocytoma
  Primitive neuroectodermal tumor
  Prostate cancer
  Prostate carcinoma
  Small-cell lung cancer
  Squamous cell carcinoma
  Varicose veins
  Vascular dementia
  X-linked intellectual disability
  Clear cell renal carcinoma
  Lung neoplasm
  Non-syndromic X-linked intellectual disability
  Attention deficit hyperactivity disorder
  Neuroblastoma
  Type-1/2 diabetes
• UniProt ID: SYPH_HUMAN
• Pfam ID: PF01284
• Sequence:
  MLLLADMDVVNQLVAGGQFRVVKEPLGFVKVLQWVFAIFAFATCGSYSGELQLSVDCANK
  TESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMG
  ALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEM
  PVCRQTGNTCKELRDPVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAP
  EKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGY
  GPQGAPTSFSNQM
• Function: Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity.
• Tissue Specificity: Expressed in the brain, with expression in the hippocampus, the neuropil in the dentate gyrus, where expression is higher in the outer half of the molecular layer than in the inner half, and in the neuropil of CA4 and CA3 . Expressed in the putamen (at protein level) .
• Reactome Pathway: Sensory processing of sound by inner hair cells of the cochlea (R-HSA-9662360)

Molecular Interaction Atlas (MIA) of This DOT

40 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Epilepsy	DISBB28L	Definitive	Altered Expression	[1]
Intellectual disability, X-linked 96	DIS14ZZ5	Definitive	X-linked recessive	[2]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[3]
Adenoma	DIS78ZEV	Strong	Posttranslational Modification	[4]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[5]
Amyloidosis	DISHTAI2	Strong	Biomarker	[6]
Breast cancer	DIS7DPX1	Strong	Biomarker	[7]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[7]
Carcinoid tumor	DISMNRDC	Strong	Biomarker	[8]
Carcinoma	DISH9F1N	Strong	Biomarker	[9]
Cognitive impairment	DISH2ERD	Strong	Altered Expression	[10]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[11]
Depression	DIS3XJ69	Strong	Altered Expression	[12]
Endometriosis	DISX1AG8	Strong	Altered Expression	[13]
Glioma	DIS5RPEH	Strong	Altered Expression	[14]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[15]
Intellectual disability	DISMBNXP	Strong	Genetic Variation	[16]
Intellectual disability, X-linked 1	DISET38E	Strong	GermlineCausalMutation	[2]
Major depressive disorder	DIS4CL3X	Strong	Biomarker	[17]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[18]
Medullary thyroid gland carcinoma	DISHBL3K	Strong	Altered Expression	[19]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[20]
Metastatic malignant neoplasm	DIS86UK6	Strong	Biomarker	[21]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[22]
Paraganglioma	DIS2XXH5	Strong	Biomarker	[23]
Pheochromocytoma	DIS56IFV	Strong	Biomarker	[24]
Primitive neuroectodermal tumor	DISFHXHA	Strong	Biomarker	[25]
Prostate cancer	DISF190Y	Strong	Altered Expression	[26]
Prostate carcinoma	DISMJPLE	Strong	Altered Expression	[26]
Small-cell lung cancer	DISK3LZD	Strong	Biomarker	[27]
Squamous cell carcinoma	DISQVIFL	Strong	Genetic Variation	[28]
Varicose veins	DISIMBN2	Strong	Biomarker	[29]
Vascular dementia	DISVO82H	Strong	Altered Expression	[30]
X-linked intellectual disability	DISYJBY3	Strong	Biomarker	[2]
Clear cell renal carcinoma	DISBXRFJ	moderate	Biomarker	[31]
Lung neoplasm	DISVARNB	moderate	Biomarker	[32]
Non-syndromic X-linked intellectual disability	DIS71AI3	Moderate	X-linked	[33]
Attention deficit hyperactivity disorder	DISL8MX9	Limited	Biomarker	[34]
Neuroblastoma	DISVZBI4	Limited	Biomarker	[35]
Type-1/2 diabetes	DISIUHAP	Limited	Biomarker	[36]

15 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Synaptophysin (SYP).	[37]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Synaptophysin (SYP).	[39]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Synaptophysin (SYP).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Synaptophysin (SYP).	[41]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Synaptophysin (SYP).	[42]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Synaptophysin (SYP).	[43]
Alitretinoin	DMME8LH	Approved	Alitretinoin decreases the expression of Synaptophysin (SYP).	[39]
Methamphetamine	DMPM4SK	Approved	Methamphetamine decreases the expression of Synaptophysin (SYP).	[44]
Abacavir	DMMN36E	Approved	Abacavir increases the expression of Synaptophysin (SYP).	[45]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Synaptophysin (SYP).	[46]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Synaptophysin (SYP).	[47]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID increases the expression of Synaptophysin (SYP).	[43]
Deguelin	DMXT7WG	Investigative	Deguelin decreases the expression of Synaptophysin (SYP).	[50]
4-hydroxy-2-nonenal	DM2LJFZ	Investigative	4-hydroxy-2-nonenal decreases the expression of Synaptophysin (SYP).	[42]
Paraoxon	DMN4ZKC	Investigative	Paraoxon decreases the expression of Synaptophysin (SYP).	[51]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the methylation of Synaptophysin (SYP).	[38]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Synaptophysin (SYP).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Synaptophysin (SYP).	[49]

References

• [1] Prolonged febrile seizure history exacerbates seizure severity in a pentylenetetrazole rat model of epilepsy.Brain Res Bull. 2020 Feb;155:137-144. doi: 10.1016/j.brainresbull.2019.11.021. Epub 2019 Dec 14.
• [2] A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation. Nat Genet. 2009 May;41(5):535-43. doi: 10.1038/ng.367. Epub 2009 Apr 19.
• [3] Anal canal adenocarcinoma with neuroendocrine features accompanying secondary extramammary Paget disease, successfully treated with modified FOLFOX6: a case report.BMC Cancer. 2018 Nov 20;18(1):1142. doi: 10.1186/s12885-018-5084-0.
• [4] Aberrant DNA methylation of synaptophysin is involved in adrenal cortisol-producing adenoma.Aging (Albany NY). 2019 Jul 28;11(14):5232-5245. doi: 10.18632/aging.102119.
• [5] A typical carcinoid of the lung - a case report with pathological correlation and propagation of the cancer stem cell line BKZ1 with synaptophysin expression.Medicine (Baltimore). 2019 Dec;98(49):e18174. doi: 10.1097/MD.0000000000018174.
• [6] Protein Profile and Morphological Alterations in Penumbra after Focal Photothrombotic Infarction in the Rat Cerebral Cortex.Mol Neurobiol. 2017 Aug;54(6):4172-4188. doi: 10.1007/s12035-016-9964-5. Epub 2016 Jun 21.
• [7] Metastatic breast cancer simulating well-differentiated neuroendocrine neoplasms of visceral organs.Hum Pathol. 2018 Dec;82:76-86. doi: 10.1016/j.humpath.2018.07.011. Epub 2018 Jul 18.
• [8] ECL-cell carcinoids and carcinoma in patients homozygous for an inactivating mutation in the gastric H(+) K(+) ATPase alpha subunit.APMIS. 2016 Jul;124(7):561-6. doi: 10.1111/apm.12546. Epub 2016 May 6.
• [9] Neuron-Specific Enolase as an Immunohistochemical Marker Is Better Than Its Reputation.J Histochem Cytochem. 2017 Dec;65(12):687-703. doi: 10.1369/0022155417733676. Epub 2017 Oct 3.
• [10] Developmental neurotoxicity in the context of multiple sevoflurane exposures: Potential role of histone deacetylase 6.Neurotoxicol Teratol. 2019 Jul-Aug;74:106813. doi: 10.1016/j.ntt.2019.106813. Epub 2019 Jun 26.
• [11] Synaptophysin expression as prognostic factor for survival in colorectal carcinomas.Rom J Morphol Embryol. 2017;58(4):1409-1415.
• [12] Gene expression profiling of 12633 genes in Alzheimer hippocampal CA1: transcription and neurotrophic factor down-regulation and up-regulation of apoptotic and pro-inflammatory signaling.J Neurosci Res. 2002 Nov 1;70(3):462-73. doi: 10.1002/jnr.10351.
• [13] Expression of microtubule associated protein 2 and synaptophysin in endometrium: high levels in deep infiltrating endometriosis lesions.Fertil Steril. 2016 Feb;105(2):435-43. doi: 10.1016/j.fertnstert.2015.10.024. Epub 2015 Nov 18.
• [14] Aberrant neuronal differentiation is common in glioma but is associated neither with epileptic seizures nor with better survival.Sci Rep. 2018 Oct 8;8(1):14965. doi: 10.1038/s41598-018-33282-5.
• [15] SYPL1 overexpression predicts poor prognosis of hepatocellular carcinoma and associates with epithelial-mesenchymal transition.Oncol Rep. 2017 Sep;38(3):1533-1542. doi: 10.3892/or.2017.5843. Epub 2017 Jul 21.
• [16] Altered synaptobrevin-II trafficking in neurons expressing a synaptophysin mutation associated with a severe neurodevelopmental disorder.Neurobiol Dis. 2017 Dec;108:298-306. doi: 10.1016/j.nbd.2017.08.021. Epub 2017 Sep 5.
• [17] Neuron-related blood inflammatory markers as an objective evaluation tool for major depressive disorder: An exploratory pilot case-control study.J Affect Disord. 2018 Nov;240:88-98. doi: 10.1016/j.jad.2018.07.040. Epub 2018 Jul 17.
• [18] Gene expression analysis of embryonic pancreas development master regulators and terminal cell fate markers in resected pancreatic cancer: A correlation with clinical outcome.Pancreatology. 2018 Dec;18(8):945-953. doi: 10.1016/j.pan.2018.09.006. Epub 2018 Sep 25.
• [19] A transplantable human medullary thyroid carcinoma as a model for RET tyrosine kinase-driven tumorigenesis.Endocr Relat Cancer. 2007 Jun;14(2):433-44. doi: 10.1677/ERC-06-0033.
• [20] Inhibition of NF-B signaling commits resveratrol-treated medulloblastoma cells to apoptosis without neuronal differentiation.J Neurooncol. 2011 Aug;104(1):169-77. doi: 10.1007/s11060-010-0496-y. Epub 2010 Dec 16.
• [21] Insulinoma-associated protein 1 expression in primary and metastatic neuroendocrine neoplasms of the gastrointestinal and pancreaticobiliary tracts.Histopathology. 2019 Oct;75(4):568-577. doi: 10.1111/his.13899. Epub 2019 Jul 29.
• [22] Differences of molecular expression mechanisms among neural cell adhesion molecule 1, synaptophysin, and chromogranin A in lung cancer cells.Pathol Int. 2012 Apr;62(4):232-45. doi: 10.1111/j.1440-1827.2011.02781.x. Epub 2012 Jan 13.
• [23] Immunohistochemical expression patterns of S100, synaptophysin, chromogranin A and neuron specific enolase in predicting malignant behaviour in paragangliomas.J BUON. 2018 Sep-Oct;23(5):1540-1545.
• [24] Expression of neuropeptides and other neuroendocrine markers in human phaeochromocytomas.Neuropeptides. 1999 Apr;33(2):159-63. doi: 10.1054/npep.1999.0012.
• [25] Malignant glioma with primitive neuroectodermal tumor-like component (MG-PNET): novel microarray findings in a pediatric patient.Clin Neuropathol. 2016 Nov/Dec;35(6):353-367. doi: 10.5414/NP300942.
• [26] A bioinformatics-to-clinic sequential approach to analysis of prostate cancer biomarkers using TCGA datasets and clinical samples: a new method for precision oncology?.Oncotarget. 2017 Aug 24;8(59):99601-99611. doi: 10.18632/oncotarget.20448. eCollection 2017 Nov 21.
• [27] P16 is a useful supplemental diagnostic marker of pulmonary small cell carcinoma in small biopsies and cytology specimens.Ann Diagn Pathol. 2018 Apr;33:23-29. doi: 10.1016/j.anndiagpath.2017.11.008. Epub 2017 Nov 11.
• [28] American Registry of Pathology Expert Opinions: Evaluation of poorly differentiated malignant neoplasms on limited samples - Gastrointestinal mucosal biopsies.Ann Diagn Pathol. 2020 Feb;44:151419. doi: 10.1016/j.anndiagpath.2019.151419. Epub 2019 Nov 15.
• [29] Antibiotics Reduce Retinal Cell Survival In Vitro.Neurotox Res. 2018 May;33(4):781-789. doi: 10.1007/s12640-017-9826-6. Epub 2017 Nov 2.
• [30] Effects of autophagy on synaptic-plasticity-related protein expression in the hippocampus CA1 of a rat model of vascular dementia.Neurosci Lett. 2019 Aug 10;707:134312. doi: 10.1016/j.neulet.2019.134312. Epub 2019 Jun 1.
• [31] Expression of erythropoietin and neuroendocrine markers in clear cell renal cell carcinoma.APMIS. 2017 Mar;125(3):213-222. doi: 10.1111/apm.12654.
• [32] Insulinoma-associated protein 1 (INSM1) is a sensitive and highly specific marker of neuroendocrine differentiation in primary lung neoplasms: an immunohistochemical study of 345 cases, including 292 whole-tissue sections.Mod Pathol. 2019 Jan;32(1):100-109. doi: 10.1038/s41379-018-0122-7. Epub 2018 Aug 28.
• [33] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [34] Interactions between MAOA and SYP polymorphisms were associated with symptoms of attention-deficit/hyperactivity disorder in Chinese Han subjects.Am J Med Genet B Neuropsychiatr Genet. 2015 Jan;168B(1):45-53. doi: 10.1002/ajmg.b.32273. Epub 2014 Dec 8.
• [35] Patient-derived organoids (PDOs) as a novel in vitro model for neuroblastoma tumours.BMC Cancer. 2019 Oct 21;19(1):970. doi: 10.1186/s12885-019-6149-4.
• [36] Characterization of somatostatin receptors and associated signaling pathways in pancreas of R6/2 transgenic mice.Biochim Biophys Acta Mol Basis Dis. 2018 Feb;1864(2):359-373. doi: 10.1016/j.bbadis.2017.11.002. Epub 2017 Nov 14.
• [37] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [38] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [39] Effects of all-trans and 9-cis retinoic acid on differentiating human neural stem cells in vitro. Toxicology. 2023 Mar 15;487:153461. doi: 10.1016/j.tox.2023.153461. Epub 2023 Feb 16.
• [40] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
• [43] The induction of cytochrome P450 2E1 by ethanol leads to the loss of synaptic proteins via PPARalpha down-regulation. Toxicology. 2017 Jun 15;385:18-27.
• [44] Patterns of selective neuronal damage in methamphetamine-user AIDS patients. J Acquir Immune Defic Syndr. 2003 Dec 15;34(5):467-74. doi: 10.1097/00126334-200312150-00004.
• [45] The antiretroviral nucleoside analogue Abacavir reduces cell growth and promotes differentiation of human medulloblastoma cells. Int J Cancer. 2009 Jul 1;125(1):235-43. doi: 10.1002/ijc.24331.
• [46] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [47] Inhibition of STAT3 expression and signaling in resveratrol-differentiated medulloblastoma cells. Neoplasia. 2008 Jul;10(7):736-44. doi: 10.1593/neo.08304.
• [48] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [49] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [50] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [51] High concentration of trichlorfon (1mM) disrupts axonal cytoskeleton and decreases the expression of plasticity-related proteins in SH-SY5Y cells. Toxicol In Vitro. 2017 Mar;39:84-92. doi: 10.1016/j.tiv.2016.12.003. Epub 2016 Dec 7.