Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGD7SKH)

DOT Name Secretagogin (SCGN)
Gene Name SCGN
Related Disease
Alzheimer disease ( )
Cardiac failure ( )
Congestive heart failure ( )
Gout ( )
Inflammatory bowel disease ( )
Non-insulin dependent diabetes ( )
Obesity ( )
Parkinson disease ( )
Pituitary adenoma ( )
Pituitary tumor ( )
Prostate cancer ( )
Prostate carcinoma ( )
Type-1/2 diabetes ( )
Carcinoma ( )
Colorectal carcinoma ( )
Small-cell lung cancer ( )
Lung carcinoma ( )
Lung squamous cell carcinoma ( )
Prediabetes syndrome ( )
UniProt ID
SEGN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13202 ; PF13499
Sequence
MDSSREPTLGRLDAAGFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTQDASKDGRIRMKELAGMFLSEDENFLLLFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHKKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAYYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Tissue Specificity
Expressed at high levels in the pancreatic islets of Langerhans and to a much lesser extent in the gastrointestinal tract (stomach, small intestine and colon), the adrenal medulla and cortex and the thyroid C-cells. In the brain, the expression is restricted to distinct subtypes of neurons with highest expression in the molecular layer of the cerebellum (stellate and basket cells), in the anterior part of the pituitary gland, in the thalamus, in the hypothalamus and in a subgroup of neocortical neurons.

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alzheimer disease DISF8S70 Strong Biomarker [1]
Cardiac failure DISDC067 Strong Biomarker [2]
Congestive heart failure DIS32MEA Strong Biomarker [2]
Gout DISHC0U7 Strong Genetic Variation [3]
Inflammatory bowel disease DISGN23E Strong Biomarker [4]
Non-insulin dependent diabetes DISK1O5Z Strong Altered Expression [5]
Obesity DIS47Y1K Strong Biomarker [6]
Parkinson disease DISQVHKL Strong Genetic Variation [1]
Pituitary adenoma DISJ5R1X Strong Biomarker [7]
Pituitary tumor DISN67JD Strong Biomarker [7]
Prostate cancer DISF190Y Strong Biomarker [8]
Prostate carcinoma DISMJPLE Strong Biomarker [8]
Type-1/2 diabetes DISIUHAP Strong Biomarker [9]
Carcinoma DISH9F1N moderate Biomarker [10]
Colorectal carcinoma DIS5PYL0 moderate Altered Expression [11]
Small-cell lung cancer DISK3LZD moderate Altered Expression [12]
Lung carcinoma DISTR26C Limited Genetic Variation [13]
Lung squamous cell carcinoma DISXPIBD Limited Genetic Variation [13]
Prediabetes syndrome DISH2I53 Limited Altered Expression [5]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Secretagogin (SCGN). [14]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Secretagogin (SCGN). [15]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Secretagogin (SCGN). [16]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Secretagogin (SCGN). [17]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of Secretagogin (SCGN). [18]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide affects the expression of Secretagogin (SCGN). [20]
Marinol DM70IK5 Approved Marinol increases the expression of Secretagogin (SCGN). [21]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Secretagogin (SCGN). [22]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Secretagogin (SCGN). [23]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Secretagogin (SCGN). [19]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Secretagogin (SCGN). [24]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Secretagogin (SCGN). [25]
------------------------------------------------------------------------------------

References

1 Unveiling the olfactory proteostatic disarrangement in Parkinson's disease by proteome-wide profiling.Neurobiol Aging. 2019 Jan;73:123-134. doi: 10.1016/j.neurobiolaging.2018.09.018. Epub 2018 Sep 25.
2 Short-Term Effects of Tolvaptan in PatientsWith Acute Heart Failure andVolume Overload.J Am Coll Cardiol. 2017 Mar 21;69(11):1409-1419. doi: 10.1016/j.jacc.2016.12.035.
3 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations. Nat Genet. 2013 Feb;45(2):145-54. doi: 10.1038/ng.2500. Epub 2012 Dec 23.
4 SCGN deficiency results in colitis susceptibility.Elife. 2019 Oct 30;8:e49910. doi: 10.7554/eLife.49910.
5 Plasma Secretagogin is Increased in Individuals with Glucose Dysregulation.Exp Clin Endocrinol Diabetes. 2021 Sep;129(9):661-665. doi: 10.1055/a-1001-2244. Epub 2019 Sep 23.
6 Genome-wide copy number variation analysis identifies novel candidate loci associated with pediatric obesity.Eur J Hum Genet. 2018 Nov;26(11):1588-1596. doi: 10.1038/s41431-018-0189-0. Epub 2018 Jul 5.
7 Proteomics and transcriptomics analyses of secretagogin down-regulation in human non-functional pituitary adenomas.Pituitary. 2003;6(4):189-202. doi: 10.1023/b:pitu.0000023426.99808.40.
8 Proteogenomic Characterization of Patient-Derived Xenografts Highlights the Role of REST in Neuroendocrine Differentiation of Castration-Resistant Prostate Cancer.Clin Cancer Res. 2019 Jan 15;25(2):595-608. doi: 10.1158/1078-0432.CCR-18-0729. Epub 2018 Oct 1.
9 Veiled Potential of Secretagogin in Diabetes: Correlation or Coincidence?.Trends Endocrinol Metab. 2019 Apr;30(4):234-243. doi: 10.1016/j.tem.2019.01.007. Epub 2019 Feb 13.
10 Neuron-Specific Enolase as an Immunohistochemical Marker Is Better Than Its Reputation.J Histochem Cytochem. 2017 Dec;65(12):687-703. doi: 10.1369/0022155417733676. Epub 2017 Oct 3.
11 Overexpression of secretagogin promotes cell apoptosis and inhibits migration and invasion of human SW480 human colorectal cancer cells.Biomed Pharmacother. 2018 May;101:342-347. doi: 10.1016/j.biopha.2018.01.147. Epub 2018 Mar 22.
12 Overexpression of secretagogin inhibits cell apoptosis and induces chemoresistance in small cell lung cancer under the regulation of miR-494.Oncotarget. 2014 Sep 15;5(17):7760-75. doi: 10.18632/oncotarget.2305.
13 Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
14 Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
15 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
16 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
17 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
18 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
19 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
20 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
21 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
22 Adipogenic Effects and Gene Expression Profiling of Firemaster? 550 Components in Human Primary Preadipocytes. Environ Health Perspect. 2017 Sep 14;125(9):097013. doi: 10.1289/EHP1318.
23 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
24 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
25 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.