Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTH0Y56P)

DOT Name Cadherin-2 (CDH2)
Synonyms CDw325; Neural cadherin; N-cadherin; CD antigen CD325
Gene Name CDH2
Related Disease
Agenesis of corpus callosum, cardiac, ocular, and genital syndrome ( )
Arrhythmogenic right ventricular dysplasia, familial, 14 ( )
Arrhythmogenic right ventricular cardiomyopathy ( )
Congenital heart disease ( )
UniProt ID
CADH2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01049 ; PF00028 ; PF08758
Sequence
MCRIAGALRTLLPLLAALLQASVEASGEIALCKTGFPEDVYSAVLSKDVHEGQPLLNVKF
SNCNGKRKVQYESSEPADFKVDEDGMVYAVRSFPLSSEHAKFLIYAQDKETQEKWQVAVK
LSLKPTLTEESVKESAEVEEIVFPRQFSKHSGHLQRQKRDWVIPPINLPENSRGPFPQEL
VRIRSDRDKNLSLRYSVTGPGADQPPTGIFIINPISGQLSVTKPLDREQIARFHLRAHAV
DINGNQVENPIDIVINVIDMNDNRPEFLHQVWNGTVPEGSKPGTYVMTVTAIDADDPNAL
NGMLRYRIVSQAPSTPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTY
GLSNTATAVITVTDVNDNPPEFTAMTFYGEVPENRVDIIVANLTVTDKDQPHTPAWNAVY
RISGGDPTGRFAIQTDPNSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQS
TATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDPDRYMQQNIRYTKLSDP
ANWLKIDPVNGQITTIAVLDRESPNVKNNIYNATFLASDNGIPPMSGTGTLQIYLLDIND
NAPQVLPQEAETCETPDPNSINITALDYDIDPNAGPFAFDLPLSPVTIKRNWTITRLNGD
FAQLNLKIKFLEAGIYEVPIIITDSGNPPKSNISILRVKVCQCDSNGDCTDVDRIVGAGL
GTGAIIAILLCIIILLILVLMFVVWMKRRDKERQAKQLLIDPEDDVRDNILKYDEEGGGE
EDQDYDLSQLQQPDTVEPDAIKPVGIRRMDERPIHAEPQYPVRSAAPHPGDIGDFINEGL
KAADNDPTAPPYDSLLVFDYEGSGSTAGSLSSLNSSSSGGEQDYDYLNDWGPRFKKLADM
YGGGDD
Function
Calcium-dependent cell adhesion protein; preferentially mediates homotypic cell-cell adhesion by dimerization with a CDH2 chain from another cell. Cadherins may thus contribute to the sorting of heterogeneous cell types. Acts as a regulator of neural stem cells quiescence by mediating anchorage of neural stem cells to ependymocytes in the adult subependymal zone: upon cleavage by MMP24, CDH2-mediated anchorage is affected, leading to modulate neural stem cell quiescence. Plays a role in cell-to-cell junction formation between pancreatic beta cells and neural crest stem (NCS) cells, promoting the formation of processes by NCS cells. Required for proper neurite branching. Required for pre- and postsynaptic organization. CDH2 may be involved in neuronal recognition mechanism. In hippocampal neurons, may regulate dendritic spine density.
KEGG Pathway
Cell adhesion molecules (hsa04514 )
Arrhythmogenic right ventricular cardiomyopathy (hsa05412 )
Reactome Pathway
Adherens junctions interactions (R-HSA-418990 )
Myogenesis (R-HSA-525793 )
Post-translational protein phosphorylation (R-HSA-8957275 )
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs) (R-HSA-381426 )

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Agenesis of corpus callosum, cardiac, ocular, and genital syndrome DISZFWB9 Strong Autosomal dominant [1]
Arrhythmogenic right ventricular dysplasia, familial, 14 DIS9VTGJ Strong Autosomal dominant [2]
Arrhythmogenic right ventricular cardiomyopathy DIS3V2BE Limited Autosomal dominant [3]
Congenital heart disease DISQBA23 Limited Autosomal dominant [3]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
5 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Cadherin-2 (CDH2). [4]
Testosterone DM7HUNW Approved Testosterone decreases the phosphorylation of Cadherin-2 (CDH2). [15]
Hydroxyflutamide DMGIZF5 Approved Hydroxyflutamide decreases the phosphorylation of Cadherin-2 (CDH2). [15]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Cadherin-2 (CDH2). [38]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Cadherin-2 (CDH2). [44]
------------------------------------------------------------------------------------
54 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Cadherin-2 (CDH2). [5]
Tretinoin DM49DUI Approved Tretinoin decreases the expression of Cadherin-2 (CDH2). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Cadherin-2 (CDH2). [7]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Cadherin-2 (CDH2). [8]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Cadherin-2 (CDH2). [9]
Arsenic DMTL2Y1 Approved Arsenic increases the expression of Cadherin-2 (CDH2). [10]
Quercetin DM3NC4M Approved Quercetin decreases the expression of Cadherin-2 (CDH2). [11]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Cadherin-2 (CDH2). [12]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Cadherin-2 (CDH2). [13]
Hydrogen peroxide DM1NG5W Approved Hydrogen peroxide decreases the expression of Cadherin-2 (CDH2). [14]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Cadherin-2 (CDH2). [16]
Decitabine DMQL8XJ Approved Decitabine decreases the expression of Cadherin-2 (CDH2). [17]
Marinol DM70IK5 Approved Marinol decreases the expression of Cadherin-2 (CDH2). [18]
Menadione DMSJDTY Approved Menadione decreases the expression of Cadherin-2 (CDH2). [19]
Panobinostat DM58WKG Approved Panobinostat decreases the expression of Cadherin-2 (CDH2). [20]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Cadherin-2 (CDH2). [21]
Folic acid DMEMBJC Approved Folic acid increases the expression of Cadherin-2 (CDH2). [22]
Capsaicin DMGMF6V Approved Capsaicin decreases the expression of Cadherin-2 (CDH2). [23]
Alitretinoin DMME8LH Approved Alitretinoin decreases the expression of Cadherin-2 (CDH2). [6]
Palbociclib DMD7L94 Approved Palbociclib increases the expression of Cadherin-2 (CDH2). [24]
Acocantherin DM7JT24 Approved Acocantherin decreases the expression of Cadherin-2 (CDH2). [25]
Thalidomide DM70BU5 Approved Thalidomide decreases the expression of Cadherin-2 (CDH2). [26]
Rofecoxib DM3P5DA Approved Rofecoxib affects the expression of Cadherin-2 (CDH2). [27]
Novobiocin DMRFWGK Approved Novobiocin decreases the expression of Cadherin-2 (CDH2). [28]
Berberine DMC5Q8X Phase 4 Berberine decreases the expression of Cadherin-2 (CDH2). [29]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Cadherin-2 (CDH2). [20]
Resveratrol DM3RWXL Phase 3 Resveratrol decreases the expression of Cadherin-2 (CDH2). [30]
Seocalcitol DMKL9QO Phase 3 Seocalcitol decreases the expression of Cadherin-2 (CDH2). [31]
HMPL-004 DM29XGY Phase 3 HMPL-004 decreases the expression of Cadherin-2 (CDH2). [32]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Cadherin-2 (CDH2). [33]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone decreases the expression of Cadherin-2 (CDH2). [34]
Thymoquinone DMVDTR2 Phase 2/3 Thymoquinone decreases the expression of Cadherin-2 (CDH2). [35]
phorbol 12-myristate 13-acetate DMJWD62 Phase 2 phorbol 12-myristate 13-acetate increases the expression of Cadherin-2 (CDH2). [36]
Delphinidin DMS2WIN Phase 2 Delphinidin decreases the expression of Cadherin-2 (CDH2). [37]
Tetrandrine DMAOJBX Phase 1 Tetrandrine decreases the expression of Cadherin-2 (CDH2). [39]
Arecoline DMFJZK3 Phase 1 Arecoline increases the expression of Cadherin-2 (CDH2). [40]
TAK-114 DMTXE19 Phase 1 TAK-114 decreases the expression of Cadherin-2 (CDH2). [41]
Flavonoid derivative 1 DMCQP0B Patented Flavonoid derivative 1 decreases the expression of Cadherin-2 (CDH2). [42]
Piperlongumine DMIZCOE Preclinical Piperlongumine decreases the expression of Cadherin-2 (CDH2). [43]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Cadherin-2 (CDH2). [45]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Cadherin-2 (CDH2). [46]
Coumarin DM0N8ZM Investigative Coumarin decreases the expression of Cadherin-2 (CDH2). [47]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Cadherin-2 (CDH2). [48]
4-hydroxy-2-nonenal DM2LJFZ Investigative 4-hydroxy-2-nonenal decreases the expression of Cadherin-2 (CDH2). [14]
Lithium chloride DMHYLQ2 Investigative Lithium chloride decreases the expression of Cadherin-2 (CDH2). [49]
Cordycepin DM72Y01 Investigative Cordycepin decreases the expression of Cadherin-2 (CDH2). [50]
BRN-3548355 DM4KXT0 Investigative BRN-3548355 increases the expression of Cadherin-2 (CDH2). [46]
Chrysin DM7V2LG Investigative Chrysin decreases the expression of Cadherin-2 (CDH2). [51]
biochanin A DM0HPWY Investigative biochanin A decreases the expression of Cadherin-2 (CDH2). [52]
Tetramethylbutylphenol DMW9CH2 Investigative Tetramethylbutylphenol increases the expression of Cadherin-2 (CDH2). [53]
Isoarnebin 4 DM0B7NO Investigative Isoarnebin 4 decreases the expression of Cadherin-2 (CDH2). [54]
NMS-873 DMYKZ6U Investigative NMS-873 decreases the expression of Cadherin-2 (CDH2). [55]
DIECKOL DMBCK4G Investigative DIECKOL decreases the expression of Cadherin-2 (CDH2). [56]
PI-3065 DMCQUWI Investigative PI-3065 decreases the expression of Cadherin-2 (CDH2). [57]
------------------------------------------------------------------------------------
⏷ Show the Full List of 54 Drug(s)

References

1 De Novo Pathogenic Variants in N-cadherin Cause a Syndromic Neurodevelopmental Disorder with Corpus Collosum, Axon, Cardiac, Ocular, and Genital Defects. Am J Hum Genet. 2019 Oct 3;105(4):854-868. doi: 10.1016/j.ajhg.2019.09.005.
2 Identification of Cadherin 2 (CDH2) Mutations in Arrhythmogenic Right Ventricular Cardiomyopathy. Circ Cardiovasc Genet. 2017 Apr;10(2):e001605. doi: 10.1161/CIRCGENETICS.116.001605.
3 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
4 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Effects of all-trans and 9-cis retinoic acid on differentiating human neural stem cells in vitro. Toxicology. 2023 Mar 15;487:153461. doi: 10.1016/j.tox.2023.153461. Epub 2023 Feb 16.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
9 Bisphenol A induce ovarian cancer cell migration via the MAPK and PI3K/Akt signalling pathways. Toxicol Lett. 2014 Sep 2;229(2):357-65. doi: 10.1016/j.toxlet.2014.07.001. Epub 2014 Jul 2.
10 Inorganic arsenic exposure promotes malignant progression by HDAC6-mediated down-regulation of HTRA1. J Appl Toxicol. 2023 Aug;43(8):1214-1224. doi: 10.1002/jat.4457. Epub 2023 Mar 11.
11 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
12 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
13 Arsenic trioxide inhibits EMT in hepatocellular carcinoma by promoting lncRNA MEG3 via PKM2. Biochem Biophys Res Commun. 2019 Jun 11;513(4):834-840. doi: 10.1016/j.bbrc.2019.04.081. Epub 2019 Apr 16.
14 Microarray analysis of H2O2-, HNE-, or tBH-treated ARPE-19 cells. Free Radic Biol Med. 2002 Nov 15;33(10):1419-32.
15 Anti-androgen 2-hydroxyflutamide modulates cadherin, catenin and androgen receptor phosphorylation in androgen-sensitive LNCaP and androgen-independent PC3 prostate cancer cell lines acting via PI3K/Akt and MAPK/ERK1/2 pathways. Toxicol In Vitro. 2017 Apr;40:324-335. doi: 10.1016/j.tiv.2017.01.019. Epub 2017 Feb 2.
16 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
17 Epigenetic silencing of SFRP5 promotes the metastasis and invasion of chondrosarcoma by expression inhibition and Wnt signaling pathway activation. Chem Biol Interact. 2018 Dec 25;296:1-8. doi: 10.1016/j.cbi.2018.08.020. Epub 2018 Aug 18.
18 ?9-tetrahydrocannabinol inhibits epithelial-mesenchymal transition and metastasis by targeting matrix metalloproteinase-9 in endometrial cancer. Oncol Lett. 2018 Jun;15(6):8527-8535. doi: 10.3892/ol.2018.8407. Epub 2018 Apr 2.
19 Vitamin K3 (menadione) suppresses epithelial-mesenchymal-transition and Wnt signaling pathway in human colorectal cancer cells. Chem Biol Interact. 2019 Aug 25;309:108725. doi: 10.1016/j.cbi.2019.108725. Epub 2019 Jun 22.
20 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
21 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
22 Higher Concentrations of Folic Acid Cause Oxidative Stress, Acute Cytotoxicity, and Long-Term Fibrogenic Changes in Kidney Epithelial Cells. Chem Res Toxicol. 2022 Nov 21;35(11):2168-2179. doi: 10.1021/acs.chemrestox.2c00258. Epub 2022 Nov 10.
23 Capsaicin inhibits the migration, invasion and EMT of renal cancer cells by inducing AMPK/mTOR-mediated autophagy. Chem Biol Interact. 2022 Oct 1;366:110043. doi: 10.1016/j.cbi.2022.110043. Epub 2022 Aug 28.
24 Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
25 Ouabain impairs cell migration, and invasion and alters gene expression of human osteosarcoma U-2 OS cells. Environ Toxicol. 2017 Nov;32(11):2400-2413. doi: 10.1002/tox.22453. Epub 2017 Aug 10.
26 Thalidomide suppresses angiogenesis and immune evasion via lncRNA FGD5-AS1/miR-454-3p/ZEB1 axis-mediated VEGFA expression and PD-1/PD-L1 checkpoint in NSCLC. Chem Biol Interact. 2021 Nov 1;349:109652. doi: 10.1016/j.cbi.2021.109652. Epub 2021 Sep 11.
27 Rofecoxib modulates multiple gene expression pathways in a clinical model of acute inflammatory pain. Pain. 2007 Mar;128(1-2):136-47.
28 Novobiocin is a novel inducer of CD38 on cells of the myelomonocytic lineage. Biochim Biophys Acta. 2002 Jan 30;1542(1-3):32-40. doi: 10.1016/s0167-4889(01)00163-x.
29 Berberine promotes bone marrow-derived mesenchymal stem cells osteogenic differentiation via canonical Wnt/-catenin signaling pathway. Toxicol Lett. 2016 Jan 5;240(1):68-80. doi: 10.1016/j.toxlet.2015.10.007. Epub 2015 Oct 22.
30 Impairment of tumor-initiating stem-like property and reversal of epithelial-mesenchymal transdifferentiation in head and neck cancer by resveratrol treatment. Mol Nutr Food Res. 2012 Aug;56(8):1247-58. doi: 10.1002/mnfr.201200150. Epub 2012 Jun 13.
31 Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
32 Andrographolide inhibits the growth of human osteosarcoma cells by suppressing Wnt/-catenin, PI3K/AKT and NF-B signaling pathways. Chem Biol Interact. 2022 Sep 25;365:110068. doi: 10.1016/j.cbi.2022.110068. Epub 2022 Jul 31.
33 Genistein-induced neuronal differentiation is associated with activation of extracellular signal-regulated kinases and upregulation of p21 and N-cadherin. J Cell Biochem. 2005 Dec 1;96(5):1061-70. doi: 10.1002/jcb.20626.
34 Cancer metastasis and EGFR signaling is suppressed by amiodarone-induced versican V2. Oncotarget. 2015 Dec 15;6(40):42976-87. doi: 10.18632/oncotarget.5621.
35 Thymoquinone suppresses invasion and metastasis in bladder cancer cells by reversing EMT through the Wnt/-catenin signaling pathway. Chem Biol Interact. 2020 Apr 1;320:109022. doi: 10.1016/j.cbi.2020.109022. Epub 2020 Feb 27.
36 Antroquinonol from Antrodia Camphorata suppresses breast tumor migration/invasion through inhibiting ERK-AP-1- and AKT-NF-B-dependent MMP-9 and epithelial-mesenchymal transition expressions. Food Chem Toxicol. 2015 Apr;78:33-41. doi: 10.1016/j.fct.2015.01.012. Epub 2015 Feb 2.
37 Delphinidin induces apoptosis and inhibits epithelial-to-mesenchymal transition via the ERK/p38 MAPK-signaling pathway in human osteosarcoma cell lines. Environ Toxicol. 2018 Jun;33(6):640-649. doi: 10.1002/tox.22548. Epub 2018 Feb 16.
38 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
39 Tetrandrine inhibits human brain glioblastoma multiforme GBM 8401 cancer cell migration and invasion in vitro. Environ Toxicol. 2019 Apr;34(4):364-374. doi: 10.1002/tox.22691. Epub 2018 Dec 13.
40 Arecoline induces epithelial mesenchymal transition in HK2 cells by upregulating the ERK-mediated signaling pathway. Environ Toxicol. 2020 Sep;35(9):1007-1014. doi: 10.1002/tox.22937. Epub 2020 May 22.
41 Methylisoindigo preferentially kills cancer stem cells by interfering cell metabolism via inhibition of LKB1 and activation of AMPK in PDACs. Mol Oncol. 2016 Jun;10(6):806-24. doi: 10.1016/j.molonc.2016.01.008. Epub 2016 Feb 4.
42 Luteolin exerts pro-apoptotic effect and anti-migration effects on A549 lung adenocarcinoma cells through the activation of MEK/ERK signaling pathway. Chem Biol Interact. 2016 Sep 25;257:26-34. doi: 10.1016/j.cbi.2016.07.028. Epub 2016 Jul 26.
43 Piperlongumine induces ROS mediated apoptosis by transcriptional regulation of SMAD4/P21/P53 genes and synergizes with doxorubicin in osteosarcoma cells. Chem Biol Interact. 2022 Feb 25;354:109832. doi: 10.1016/j.cbi.2022.109832. Epub 2022 Jan 24.
44 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
45 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
46 The cigarette smoke components induced the cell proliferation and epithelial to mesenchymal transition via production of reactive oxygen species in endometrial adenocarcinoma cells. Food Chem Toxicol. 2018 Nov;121:657-665. doi: 10.1016/j.fct.2018.09.023. Epub 2018 Sep 17.
47 A synthetic coumarin derivative (4-flourophenylacetamide-acetyl coumarin) impedes cell cycle at G0/G1 stage, induces apoptosis, and inhibits metastasis via ROS-mediated p53 and AKT signaling pathways in A549 cells. J Biochem Mol Toxicol. 2020 Oct;34(10):e22553. doi: 10.1002/jbt.22553. Epub 2020 Jun 24.
48 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
49 Effects of lithium and valproic acid on gene expression and phenotypic markers in an NT2 neurosphere model of neural development. PLoS One. 2013;8(3):e58822.
50 Cordycepin Inhibits Triple-Negative Breast Cancer Cell Migration and Invasion by Regulating EMT-TFs SLUG, TWIST1, SNAIL1, and ZEB1. Front Oncol. 2022 Jun 14;12:898583. doi: 10.3389/fonc.2022.898583. eCollection 2022.
51 Chrysin inhibit human melanoma A375.S2 cell migration and invasion via affecting MAPK signaling and NF-B signaling pathway in vitro. Environ Toxicol. 2019 Apr;34(4):434-442. doi: 10.1002/tox.22697. Epub 2018 Dec 22.
52 Mechanisms of the growth inhibitory effects of the isoflavonoid biochanin A on LNCaP cells and xenografts. Prostate. 2002 Aug 1;52(3):201-12.
53 Effect of benzophenone-1 and octylphenol on the regulation of epithelial-mesenchymal transition via an estrogen receptor-dependent pathway in estrogen receptor expressing ovarian cancer cells. Food Chem Toxicol. 2016 Jul;93:58-65. doi: 10.1016/j.fct.2016.04.026. Epub 2016 May 1.
54 Shikonin suppresses small cell lung cancer growth via inducing ATF3-mediated ferroptosis to promote ROS accumulation. Chem Biol Interact. 2023 Sep 1;382:110588. doi: 10.1016/j.cbi.2023.110588. Epub 2023 Jun 1.
55 Interleukin-6 induced overexpression of valosin-containing protein (VCP)/p97 is associated with androgen-independent prostate cancer (AIPC) progression. J Cell Physiol. 2018 Oct;233(10):7148-7164. doi: 10.1002/jcp.26639. Epub 2018 Apr 25.
56 Dieckol inhibits non-small-cell lung cancer cell proliferation and migration by regulating the PI3K/AKT signaling pathway. J Biochem Mol Toxicol. 2019 Aug;33(8):e22346. doi: 10.1002/jbt.22346. Epub 2019 Jul 10.
57 PI3K inhibitor PI-3065 induces apoptosis in hepatocellular carcinoma cells by targeting survivin. Chem Biol Interact. 2023 Feb 1;371:110343. doi: 10.1016/j.cbi.2023.110343. Epub 2023 Jan 6.