Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTI4WTOP)

DOT Name Peroxisome proliferator-activated receptor delta (PPARD)
Synonyms PPAR-delta; NUCI; Nuclear hormone receptor 1; NUC1; Nuclear receptor subfamily 1 group C member 2; Peroxisome proliferator-activated receptor beta; PPAR-beta
Gene Name PPARD
UniProt ID
PPARD_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
1GWX ; 1Y0S ; 2AWH ; 2B50 ; 2BAW ; 2ENV ; 2GWX ; 2J14 ; 2Q5G ; 2XYJ ; 2XYW ; 2XYX ; 2ZNP ; 2ZNQ ; 3D5F ; 3DY6 ; 3ET2 ; 3GWX ; 3GZ9 ; 3OZ0 ; 3PEQ ; 3SP9 ; 3TKM ; 5U3Q ; 5U3R ; 5U3S ; 5U3T ; 5U3U ; 5U3V ; 5U3W ; 5U3X ; 5U3Y ; 5U3Z ; 5U40 ; 5U41 ; 5U42 ; 5U43 ; 5U44 ; 5U45 ; 5U46 ; 5XMX ; 5Y7X ; 5ZXI ; 6A6P ; 7F80 ; 7VWE ; 7VWF ; 7VWG ; 7VWH ; 7W0G ; 7WGL ; 7WGN ; 8HF8 ; 8HUL ; 8HUO
Pfam ID
PF00104 ; PF00105
Sequence
MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
Function
Ligand-activated transcription factor key mediator of energy metabolism in adipose tissues. Receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. Has a preference for poly-unsaturated fatty acids, such as gamma-linoleic acid and eicosapentanoic acid. Once activated by a ligand, the receptor binds to promoter elements of target genes. Regulates the peroxisomal beta-oxidation pathway of fatty acids. Functions as transcription activator for the acyl-CoA oxidase gene. Decreases expression of NPC1L1 once activated by a ligand.
Tissue Specificity Ubiquitous with maximal levels in placenta and skeletal muscle.
KEGG Pathway
PPAR sig.ling pathway (hsa03320 )
Efferocytosis (hsa04148 )
Wnt sig.ling pathway (hsa04310 )
Pathways in cancer (hsa05200 )
Acute myeloid leukemia (hsa05221 )
Reactome Pathway
Regulation of pyruvate dehydrogenase (PDH) complex (R-HSA-204174 )
Nuclear Receptor transcription pathway (R-HSA-383280 )
Signaling by Retinoic Acid (R-HSA-5362517 )
Carnitine metabolism (R-HSA-200425 )

Molecular Interaction Atlas (MIA) of This DOT

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 2 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Bortezomib DMNO38U Approved Peroxisome proliferator-activated receptor delta (PPARD) increases the response to substance of Bortezomib. [45]
Thalidomide DM70BU5 Approved Peroxisome proliferator-activated receptor delta (PPARD) increases the response to substance of Thalidomide. [46]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Peroxisome proliferator-activated receptor delta (PPARD). [1]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Peroxisome proliferator-activated receptor delta (PPARD). [34]
------------------------------------------------------------------------------------
55 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [2]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [3]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [6]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [7]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [8]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [9]
Marinol DM70IK5 Approved Marinol decreases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [10]
Zoledronate DMIXC7G Approved Zoledronate increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [11]
Dexamethasone DMMWZET Approved Dexamethasone decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [12]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [13]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [14]
Hydroquinone DM6AVR4 Approved Hydroquinone increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [15]
Rosiglitazone DMILWZR Approved Rosiglitazone increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [16]
Ethanol DMDRQZU Approved Ethanol increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [17]
Aspirin DM672AH Approved Aspirin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [18]
Indomethacin DMSC4A7 Approved Indomethacin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [19]
Fenofibrate DMFKXDY Approved Fenofibrate increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [20]
Sulindac DM2QHZU Approved Sulindac increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [21]
Capsaicin DMGMF6V Approved Capsaicin decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [22]
Daunorubicin DMQUSBT Approved Daunorubicin decreases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
Pioglitazone DMKJ485 Approved Pioglitazone increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [20]
Bezafibrate DMZDCS0 Approved Bezafibrate increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [24]
Eicosapentaenoic acid/docosa-hexaenoic acid DMMUCG4 Approved Eicosapentaenoic acid/docosa-hexaenoic acid increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [24]
Gemfibrozil DMD8Q3J Approved Gemfibrozil increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [20]
Felodipine DMOSW35 Approved Felodipine increases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
Pitavastatin DMJH792 Approved Pitavastatin increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [25]
Idarubicin DMM0XGL Approved Idarubicin decreases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [26]
Lacidipine DMQP5I3 Phase 4 Lacidipine increases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
Resveratrol DM3RWXL Phase 3 Resveratrol increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [27]
Curcumin DMQPH29 Phase 3 Curcumin decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [28]
EXISULIND DMBY56U Phase 3 EXISULIND increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [29]
Cilnidipine DM1975O Phase 3 Cilnidipine decreases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
LY-518674 DMBM2I9 Phase 2 LY-518674 increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [20]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [30]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [31]
PMID26394986-Compound-22 DM43Z1G Patented PMID26394986-Compound-22 decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [32]
NS-220 DMQ82T5 Discontinued in Phase 2 NS-220 increases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [33]
PIRINIXIC ACID DM82Y75 Preclinical PIRINIXIC ACID increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [8]
Nemorubicin DMX7Q3H Preclinical Nemorubicin decreases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [23]
Nimesulide DMR1NMD Terminated Nimesulide increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [19]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [35]
Deguelin DMXT7WG Investigative Deguelin decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [36]
Okadaic acid DM47CO1 Investigative Okadaic acid increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [37]
Arachidonic acid DMUOQZD Investigative Arachidonic acid increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [24]
ELLAGIC ACID DMX8BS5 Investigative ELLAGIC ACID decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [38]
Oleic acid DM54O1Z Investigative Oleic acid increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [24]
GW7647 DM9RD0C Investigative GW7647 increases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [39]
15-deoxy-Delta(12, 14)-prostaglandin J(2) DM8VUX3 Investigative 15-deoxy-Delta(12, 14)-prostaglandin J(2) increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [40]
Linoleic acid DMDGPY9 Investigative Linoleic acid decreases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [41]
Icosapentum DMF1CM7 Investigative Icosapentum increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [24]
ISORHAMNETIN DMQ4Z6E Investigative ISORHAMNETIN increases the activity of Peroxisome proliferator-activated receptor delta (PPARD). [42]
Alpha-linolenic acid DMY64HE Investigative Alpha-linolenic acid increases the expression of Peroxisome proliferator-activated receptor delta (PPARD). [8]
------------------------------------------------------------------------------------
⏷ Show the Full List of 55 Drug(s)
3 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT
Drug Name Drug ID Highest Status Interaction REF
Fibrates DMFNTMY Investigative Fibrates affects the binding of Peroxisome proliferator-activated receptor delta (PPARD). [43]
Ro 41-5253 DMSJLWP Investigative Ro 41-5253 affects the binding of Peroxisome proliferator-activated receptor delta (PPARD). [44]
GW2433 DMEAIQC Investigative GW2433 affects the binding of Peroxisome proliferator-activated receptor delta (PPARD). [44]
------------------------------------------------------------------------------------

References

1 Integrated 'omics analysis reveals new drug-induced mitochondrial perturbations in human hepatocytes. Toxicol Lett. 2018 Jun 1;289:1-13.
2 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
3 Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Systematic transcriptome-based comparison of cellular adaptive stress response activation networks in hepatic stem cell-derived progeny and primary human hepatocytes. Toxicol In Vitro. 2021 Jun;73:105107. doi: 10.1016/j.tiv.2021.105107. Epub 2021 Feb 3.
8 Cross-talk between vitamin D receptor (VDR)- and peroxisome proliferator-activated receptor (PPAR)-signaling in melanoma cells. Anticancer Res. 2009 Sep;29(9):3647-58.
9 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
10 (9)-Tetrahydrocannabinol upregulates fatty acid 2-hydroxylase (FA2H) via PPAR induction: A possible evidence for the cancellation of PPAR/-mediated inhibition of PPAR in MDA-MB-231?cells. Arch Biochem Biophys. 2019 Feb 15;662:219-225. doi: 10.1016/j.abb.2018.12.011. Epub 2018 Dec 13.
11 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
12 Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
13 Growth inhibition of ovarian tumor-initiating cells by niclosamide. Mol Cancer Ther. 2012 Aug;11(8):1703-12.
14 Cannabidiol induces antioxidant pathways in keratinocytes by targeting BACH1. Redox Biol. 2020 Jan;28:101321. doi: 10.1016/j.redox.2019.101321. Epub 2019 Sep 5.
15 Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
16 Improved skeletal muscle oxidative enzyme activity and restoration of PGC-1 alpha and PPAR beta/delta gene expression upon rosiglitazone treatment in obese patients with type 2 diabetes mellitus. Int J Obes (Lond). 2007 Aug;31(8):1302-10. doi: 10.1038/sj.ijo.0803567. Epub 2007 Feb 20.
17 Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
18 Aspirin-induced apoptosis in jurkat cells is not mediated by peroxisome proliferator-activated receptor delta. Mol Cell Biochem. 2004 Nov;266(1-2):57-63. doi: 10.1023/b:mcbi.0000049138.67699.7b.
19 Regulation of peroxisome proliferator-activated receptor-beta/delta by the APC/beta-CATENIN pathway and nonsteroidal antiinflammatory drugs. Mol Carcinog. 2009 Oct;48(10):942-52. doi: 10.1002/mc.20546.
20 On the mechanism for PPAR agonists to enhance ABCA1 gene expression. Atherosclerosis. 2009 Aug;205(2):413-9. doi: 10.1016/j.atherosclerosis.2009.01.008. Epub 2009 Jan 19.
21 Functional characterization of peroxisome proliferator-activated receptor-/ expression in colon cancer. Mol Carcinog. 2011 Nov;50(11):884-900. doi: 10.1002/mc.20757. Epub 2011 Mar 11.
22 Transient receptor potential vanilloid-1 signaling as a regulator of human sebocyte biology. J Invest Dermatol. 2009 Feb;129(2):329-39. doi: 10.1038/jid.2008.258. Epub 2008 Sep 4.
23 Quantitative high-throughput profiling of environmental chemicals and drugs that modulate farnesoid X receptor. Sci Rep. 2014 Sep 26;4:6437. doi: 10.1038/srep06437.
24 The ligands/activators for peroxisome proliferator-activated receptor alpha (PPARalpha) and PPARgamma increase Cu2+,Zn2+-superoxide dismutase and decrease p22phox message expressions in primary endothelial cells. Metabolism. 2001 Jan;50(1):3-11.
25 Regulation mechanism of ABCA1 expression by statins in hepatocytes. Eur J Pharmacol. 2011 Jul 15;662(1-3):9-14. doi: 10.1016/j.ejphar.2011.04.043. Epub 2011 May 1.
26 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
27 Novel PPAR pan agonist, ZBH ameliorates hyperlipidemia and insulin resistance in high fat diet induced hyperlipidemic hamster. PLoS One. 2014 Apr 23;9(4):e96056. doi: 10.1371/journal.pone.0096056. eCollection 2014.
28 Curcumin suppresses PPARdelta expression and related genes in HT-29 cells. World J Gastroenterol. 2009 Mar 21;15(11):1346-52. doi: 10.3748/wjg.15.1346.
29 PPARgamma-mediated antineoplastic effect of NSAID sulindac on human oral squamous carcinoma cells. Int J Cancer. 2002 Apr 20;98(6):817-23.
30 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
31 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
32 Novel nitro-oxy derivatives of celecoxib for the regulation of colon cancer cell growth. Chem Biol Interact. 2009 Dec 10;182(2-3):183-90.
33 A novel selective peroxisome proliferator-activated receptor alpha agonist, 2-methyl-c-5-[4-[5-methyl-2-(4-methylphenyl)-4-oxazolyl]butyl]-1,3-dioxane-r-2-carboxylic acid (NS-220), potently decreases plasma triglyceride and glucose levels and modifies lipoprotein profiles in KK-Ay mice. J Pharmacol Exp Ther. 2004 Jun;309(3):970-7. doi: 10.1124/jpet.103.064659. Epub 2004 Feb 24.
34 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
35 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
36 Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
37 Okadaic acid activates Wnt/-catenin-signaling in human HepaRG cells. Arch Toxicol. 2019 Jul;93(7):1927-1939. doi: 10.1007/s00204-019-02489-4. Epub 2019 May 21.
38 Interactive gene expression pattern in prostate cancer cells exposed to phenolic antioxidants. Life Sci. 2002 Mar 1;70(15):1821-39.
39 Impact of environmental chemicals on key transcription regulators and correlation to toxicity end points within EPA's ToxCast program. Chem Res Toxicol. 2010 Mar 15;23(3):578-90. doi: 10.1021/tx900325g.
40 Indomethacin induces apoptosis in 786-O renal cell carcinoma cells by activating mitogen-activated protein kinases and AKT. Eur J Pharmacol. 2007 Jun 1;563(1-3):49-60. doi: 10.1016/j.ejphar.2007.01.071. Epub 2007 Feb 8.
41 Expression of cFABP and PPAR in trophoblast cells: effect of PPAR ligands on linoleic acid uptake and differentiation. Biochim Biophys Acta. 2005 Feb 21;1687(1-3):181-94. doi: 10.1016/j.bbalip.2004.11.017.
42 Isorhamnetin inhibits proliferation and invasion and induces apoptosis through the modulation of peroxisome proliferator-activated receptor activation pathway in gastric cancer. J Biol Chem. 2012 Nov 2;287(45):38028-40. doi: 10.1074/jbc.M112.388702. Epub 2012 Sep 19.
43 Fibrate and statin synergistically increase the transcriptional activities of PPARalpha/RXRalpha and decrease the transactivation of NFkappaB. Biochem Biophys Res Commun. 2002 Jan 11;290(1):131-9. doi: 10.1006/bbrc.2001.6141.
44 A widely used retinoic acid receptor antagonist induces peroxisome proliferator-activated receptor-gamma activity. Mol Pharmacol. 2007 May;71(5):1251-7. doi: 10.1124/mol.106.033662. Epub 2007 Feb 8.
45 Mechanisms of peripheral neuropathy associated with bortezomib and vincristine in patients with newly diagnosed multiple myeloma: a prospective analysis of data from the HOVON-65/GMMG-HD4 trial. Lancet Oncol. 2010 Nov;11(11):1057-65. doi: 10.1016/S1470-2045(10)70206-0. Epub 2010 Sep 21.
46 Genetic factors underlying the risk of thalidomide-related neuropathy in patients with multiple myeloma. J Clin Oncol. 2011 Mar 1;29(7):797-804. doi: 10.1200/JCO.2010.28.0792. Epub 2011 Jan 18.