Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOJ8QFF)

• DOT Name: Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA)
• Synonyms: EC 1.3.5.1; Flavoprotein subunit of complex II; Fp
• Gene Name: SDHA
• Related Disease:
  Ataxia, early-onset, with oculomotor apraxia and hypoalbuminemia
  Attention deficit hyperactivity disorder
  Cardiomyopathy
  Gastric adenocarcinoma
  Hereditary pheochromocytoma-paraganglioma
  Leigh syndrome
  Melanoma
  Pancreatic neuroendocrine tumor
  Paragangliomas 5
  Advanced cancer
  Astrocytoma
  Autosomal dominant optic atrophy, classic form
  Breast cancer
  Breast carcinoma
  Breast neoplasm
  Clear cell renal carcinoma
  Congenital diaphragmatic hernia
  Dilated cardiomyopathy 1A
  Hereditary neoplastic syndrome
  Mitochondrial complex II deficiency, nuclear type 1
  Mitochondrial disease
  Multiple endocrine neoplasia type 1
  Neurodegeneration with ataxia and late-onset optic atrophy
  Non-small-cell lung cancer
  Pheochromocytoma
  Renal carcinoma
  Renal cell carcinoma
  Hepatocellular carcinoma
  Neuroblastoma
  Gastrointestinal stromal tumour
  Obsolete familial isolated dilated cardiomyopathy
  Obsolete Leigh syndrome with leukodystrophy
  Obsolete mitochondrial complex II deficiency
  Cervical cancer
  Familial dilated cardiomyopathy
  Bone osteosarcoma
  Cervical carcinoma
  Leukodystrophy
  Non-insulin dependent diabetes
  Osteoarthritis
  Osteosarcoma
• UniProt ID: SDHA_HUMAN
• PDB ID: 6VAX; 8GS8
• EC Number: 1.3.5.1
• Pfam ID: PF00890 ; PF02910
• Sequence:
  MSGVRGLSRLLSARRLALAKAWPTVLQTGTRGFHFTVDGNKRASAKVSDSISAQYPVVDH
  EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
  WHFYDTVKGSDWLGDQDAIHYMTEQAPAAVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
  GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIALCIE
  DGSIHRIRAKNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
  YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
  KDHVYLQLHHLPPEQLATRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
  VLRHVNGQDQIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIEESCRPGDK
  VPPIKPNAGEESVMNLDKLRFADGSIRTSELRLSMQKSMQNHAAVFRVGSVLQEGCGKIS
  KLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKVR
  IDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLEYRPVIDKTLNEADCATVPPA
  IRSY
• Function: Flavoprotein (FP) subunit of succinate dehydrogenase (SDH) that is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Can act as a tumor suppressor.
• KEGG Pathway:
  Citrate cycle (TCA cycle) (hsa00020)
  Oxidative phosphorylation (hsa00190)
  Metabolic pathways (hsa01100)
  Carbon metabolism (hsa01200)
  Thermogenesis (hsa04714)
  Non-alcoholic fatty liver disease (hsa04932)
  Alzheimer disease (hsa05010)
  Parkinson disease (hsa05012)
  Amyotrophic lateral sclerosis (hsa05014)
  Huntington disease (hsa05016)
  Prion disease (hsa05020)
  Pathways of neurodegeneration - multiple diseases (hsa05022)
  Chemical carcinogenesis - reactive oxygen species (hsa05208)
  Diabetic cardiomyopathy (hsa05415)
• Reactome Pathway:
  Citric acid cycle (TCA cycle) (R-HSA-71403)
  Respiratory electron transport (R-HSA-611105)
• BioCyc Pathway: MetaCyc:ENSG00000073578-MONOMER

Molecular Interaction Atlas (MIA) of This DOT

41 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Ataxia, early-onset, with oculomotor apraxia and hypoalbuminemia	DIS8CFD7	Definitive	Altered Expression	[1]
Attention deficit hyperactivity disorder	DISL8MX9	Definitive	CausalMutation	[2]
Cardiomyopathy	DISUPZRG	Definitive	Genetic Variation	[3]
Gastric adenocarcinoma	DISWWLTC	Definitive	Biomarker	[4]
Hereditary pheochromocytoma-paraganglioma	DISP9K7L	Definitive	Autosomal dominant	[5]
Leigh syndrome	DISWQU45	Definitive	Autosomal recessive	[6]
Melanoma	DIS1RRCY	Definitive	Biomarker	[4]
Pancreatic neuroendocrine tumor	DISDMPU0	Definitive	Biomarker	[7]
Paragangliomas 5	DISKSBCQ	Definitive	Autosomal dominant	[8]
Advanced cancer	DISAT1Z9	Strong	Genetic Variation	[9]
Astrocytoma	DISL3V18	Strong	Biomarker	[10]
Autosomal dominant optic atrophy, classic form	DISXUAV9	Strong	Genetic Variation	[11]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[12]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[12]
Breast neoplasm	DISNGJLM	Strong	Biomarker	[12]
Clear cell renal carcinoma	DISBXRFJ	Strong	Genetic Variation	[13]
Congenital diaphragmatic hernia	DIS0IPVU	Strong	Altered Expression	[14]
Dilated cardiomyopathy 1A	DIS0RK9Z	Strong	Genetic Variation	[15]
Hereditary neoplastic syndrome	DISGXLG5	Strong	Genetic Variation	[8]
Mitochondrial complex II deficiency, nuclear type 1	DISJ424P	Strong	Autosomal recessive	[16]
Mitochondrial disease	DISKAHA3	Strong	Genetic Variation	[17]
Multiple endocrine neoplasia type 1	DIS0RJRK	Strong	Genetic Variation	[18]
Neurodegeneration with ataxia and late-onset optic atrophy	DISVIZJR	Strong	Autosomal dominant	[19]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Genetic Variation	[20]
Pheochromocytoma	DIS56IFV	Strong	Genetic Variation	[8]
Renal carcinoma	DISER9XT	Strong	Genetic Variation	[21]
Renal cell carcinoma	DISQZ2X8	Strong	Genetic Variation	[13]
Hepatocellular carcinoma	DIS0J828	moderate	Altered Expression	[22]
Neuroblastoma	DISVZBI4	moderate	Altered Expression	[23]
Gastrointestinal stromal tumour	DIS6TJYS	Supportive	Autosomal dominant	[24]
Obsolete familial isolated dilated cardiomyopathy	DIS4FXO4	Supportive	Autosomal dominant	[15]
Obsolete Leigh syndrome with leukodystrophy	DISABU9D	Supportive	Autosomal recessive	[25]
Obsolete mitochondrial complex II deficiency	DIS67XU0	Supportive	Autosomal recessive	[3]
Cervical cancer	DISFSHPF	Disputed	Biomarker	[26]
Familial dilated cardiomyopathy	DISBHDU9	Disputed	GermlineCausalMutation	[15]
Bone osteosarcoma	DIST1004	Limited	Biomarker	[27]
Cervical carcinoma	DIST4S00	Limited	Biomarker	[26]
Leukodystrophy	DISVY1TT	Limited	Genetic Variation	[17]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[28]
Osteoarthritis	DIS05URM	Limited	Biomarker	[29]
Osteosarcoma	DISLQ7E2	Limited	Biomarker	[27]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Fluorouracil	DMUM7HZ	Approved	Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA) affects the response to substance of Fluorouracil.	[51]

18 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[30]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[31]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[32]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[33]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[34]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[35]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[36]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[37]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[38]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[39]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[40]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[41]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[42]
Tofacitinib	DMBS370	Approved	Tofacitinib increases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[43]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[45]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[48]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[49]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[50]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the acetylation of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[44]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[47]

1 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
DNCB	DMDTVYC	Phase 2	DNCB affects the binding of Succinate dehydrogenase flavoprotein subunit, mitochondrial (SDHA).	[46]

References

• [1] Lack of aprataxin impairs mitochondrial functions via downregulation of the APE1/NRF1/NRF2 pathway.Hum Mol Genet. 2015 Aug 15;24(16):4516-29. doi: 10.1093/hmg/ddv183. Epub 2015 May 14.
• [2] Clinical Characterization of the Pheochromocytoma and Paraganglioma Susceptibility Genes SDHA, TMEM127, MAX, and SDHAF2 for Gene-Informed Prevention.JAMA Oncol. 2017 Sep 1;3(9):1204-1212. doi: 10.1001/jamaoncol.2017.0223.
• [3] Recessive germline SDHA and SDHB mutations causing leukodystrophy and isolated mitochondrial complex II deficiency. J Med Genet. 2012 Sep;49(9):569-77. doi: 10.1136/jmedgenet-2012-101146.
• [4] Pathogenic Germline Variants in 10,389 Adult Cancers.Cell. 2018 Apr 5;173(2):355-370.e14. doi: 10.1016/j.cell.2018.03.039.
• [5] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [6] Flexible and scalable diagnostic filtering of genomic variants using G2P with Ensembl VEP. Nat Commun. 2019 May 30;10(1):2373. doi: 10.1038/s41467-019-10016-3.
• [7] Succinate Dehydrogenase (SDH)-Deficient Pancreatic Neuroendocrine Tumor Expands the SDH-Related Tumor Spectrum.J Clin Endocrinol Metab. 2015 Oct;100(10):E1386-93. doi: 10.1210/jc.2015-2689. Epub 2015 Aug 10.
• [8] Clinical Aspects of SDHA-Related Pheochromocytoma and Paraganglioma: A Nationwide Study. J Clin Endocrinol Metab. 2018 Feb 1;103(2):438-445. doi: 10.1210/jc.2017-01762.
• [9] Interaction of germline variants in a family with a history of early-onset clear cell renal cell carcinoma.Mol Genet Genomic Med. 2019 Mar;7(3):e556. doi: 10.1002/mgg3.556. Epub 2019 Jan 24.
• [10] ACTB and SDHA Are Suitable Endogenous Reference Genes for Gene Expression Studies in Human Astrocytomas Using Quantitative RT-PCR.Technol Cancer Res Treat. 2018 Jan 1;17:1533033818802318. doi: 10.1177/1533033818802318.
• [11] Fluoride-induced renal dysfunction via respiratory chain complex abnormal expression and fusion elevation in mice.Chemosphere. 2020 Jan;238:124607. doi: 10.1016/j.chemosphere.2019.124607. Epub 2019 Aug 17.
• [12] Identification of endogenous reference genes for qRT-PCR analysis in normal matched breast tumor tissues.Oncol Res. 2009;17(8):353-65. doi: 10.3727/096504009788428460.
• [13] The Impact Of Succinate Dehydrogenase Gene (SDH) Mutations In Renal Cell Carcinoma (RCC): A Systematic Review.Onco Targets Ther. 2019 Sep 26;12:7929-7940. doi: 10.2147/OTT.S207460. eCollection 2019.
• [14] The effects of tracheal occlusion on Wnt signaling in a rabbit model of congenital diaphragmatic hernia.J Pediatr Surg. 2019 May;54(5):937-944. doi: 10.1016/j.jpedsurg.2019.01.024. Epub 2019 Jan 31.
• [15] Familial neonatal isolated cardiomyopathy caused by a mutation in the flavoprotein subunit of succinate dehydrogenase. Eur J Hum Genet. 2010 Oct;18(10):1160-5. doi: 10.1038/ejhg.2010.83. Epub 2010 Jun 16.
• [16] Compound heterozygous mutations in the flavoprotein gene of the respiratory chain complex II in a patient with Leigh syndrome. Hum Genet. 2000 Feb;106(2):236-43. doi: 10.1007/s004390051033.
• [17] SDHA mutations causing a multisystem mitochondrial disease: novel mutations and genetic overlap with hereditary tumors.Eur J Hum Genet. 2015 Feb;23(2):202-9. doi: 10.1038/ejhg.2014.80. Epub 2014 Apr 30.
• [18] Heterogeneous genetic background of the association of pheochromocytoma/paraganglioma and pituitary adenoma: results from a large patient cohort.J Clin Endocrinol Metab. 2015 Mar;100(3):E531-41. doi: 10.1210/jc.2014-3399. Epub 2014 Dec 12.
• [19] Late-onset optic atrophy, ataxia, and myopathy associated with a mutation of a complex II gene. Ann Neurol. 2000 Sep;48(3):330-5.
• [20] Genetic variants in genes of tricarboxylic acid cycle key enzymes are associated with prognosis of patients with non-small cell lung cancer.Lung Cancer. 2015 Feb;87(2):162-8. doi: 10.1016/j.lungcan.2014.12.005. Epub 2014 Dec 18.
• [21] Renal carcinoma associated with a novel succinate dehydrogenase A mutation: a case report and review of literature of a rare subtype of renal carcinoma.Hum Pathol. 2015 Dec;46(12):1951-5. doi: 10.1016/j.humpath.2015.07.027. Epub 2015 Sep 5.
• [22] SDHC-related deficiency of SDH complex activity promotes growth and metastasis of hepatocellular carcinoma via ROS/NFB signaling.Cancer Lett. 2019 Oct 1;461:44-55. doi: 10.1016/j.canlet.2019.07.001. Epub 2019 Jul 3.
• [23] Reliable transcript quantification by real-time reverse transcriptase-polymerase chain reaction in primary neuroblastoma using normalization to averaged expression levels of the control genes HPRT1 and SDHA.J Mol Diagn. 2005 Feb;7(1):89-96. doi: 10.1016/S1525-1578(10)60013-X.
• [24] Succinate dehydrogenase deficiency in pediatric and adult gastrointestinal stromal tumors. Front Oncol. 2013 May 17;3:117. doi: 10.3389/fonc.2013.00117. eCollection 2013.
• [25] Leigh syndrome caused by mutations in the flavoprotein (Fp) subunit of succinate dehydrogenase (SDHA). J Neurol Neurosurg Psychiatry. 2006 Jan;77(1):74-6. doi: 10.1136/jnnp.2005.067041.
• [26] Integrative genomics analysis of chromosome 5p gain in cervical cancer reveals target over-expressed genes, including Drosha.Mol Cancer. 2008 Jun 17;7:58. doi: 10.1186/1476-4598-7-58.
• [27] 2-Methoxyestradiol Affects Mitochondrial Biogenesis Pathway and Succinate Dehydrogenase Complex Flavoprotein Subunit A in Osteosarcoma Cancer Cells.Cancer Genomics Proteomics. 2018 Jan-Feb;15(1):73-89. doi: 10.21873/cgp.20067.
• [28] The effect of very-low-calorie diet on mitochondrial dysfunction in subcutaneous adipose tissue and peripheral monocytes of obese subjects with type 2 diabetes mellitus.Physiol Res. 2017 Nov 24;66(5):811-822. doi: 10.33549/physiolres.933469. Epub 2017 Jul 18.
• [29] Mitochondrial dysregulation of osteoarthritic human articular chondrocytes analyzed by proteomics: a decrease in mitochondrial superoxide dismutase points to a redox imbalance.Mol Cell Proteomics. 2009 Jan;8(1):172-89. doi: 10.1074/mcp.M800292-MCP200. Epub 2008 Sep 9.
• [30] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [31] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [32] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [33] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [34] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [35] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [36] Aberrant cell proliferation by enhanced mitochondrial biogenesis via mtTFA in arsenical skin cancers. Am J Pathol. 2011 May;178(5):2066-76.
• [37] Quantitative proteomic analysis of HepG2 cells treated with quercetin suggests IQGAP1 involved in quercetin-induced regulation of cell proliferation and migration. OMICS. 2009 Apr;13(2):93-103. doi: 10.1089/omi.2008.0075.
• [38] Proteomics-based identification of differentially abundant proteins from human keratinocytes exposed to arsenic trioxide. J Proteomics Bioinform. 2014 Jul;7(7):166-178.
• [39] Proteomic analysis revealed association of aberrant ROS signaling with suberoylanilide hydroxamic acid-induced autophagy in Jurkat T-leukemia cells. Autophagy. 2010 Aug;6(6):711-24. doi: 10.4161/auto.6.6.12397. Epub 2010 Aug 17.
• [40] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [41] THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
• [42] PPARgama activation rescues mitochondrial function from inhibition of complex I and loss of PINK1. Exp Neurol. 2014 Mar;253:16-27.
• [43] White-to-brown metabolic conversion of human adipocytes by JAK inhibition. Nat Cell Biol. 2015 Jan;17(1):57-67. doi: 10.1038/ncb3075. Epub 2014 Dec 8.
• [44] Resveratrol induces a mitochondrial complex I-dependent increase in NADH oxidation responsible for sirtuin activation in liver cells. J Biol Chem. 2013 Dec 20;288(51):36662-75. doi: 10.1074/jbc.M113.466490. Epub 2013 Oct 31.
• [45] Gene-expression profiling during curcumin-induced apoptosis reveals downregulation of CXCR4. Exp Hematol. 2007 Jan;35(1):84-95.
• [46] Proteomic analysis of the cellular response to a potent sensitiser unveils the dynamics of haptenation in living cells. Toxicology. 2020 Dec 1;445:152603. doi: 10.1016/j.tox.2020.152603. Epub 2020 Sep 28.
• [47] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [48] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [49] Alternatives for the worse: Molecular insights into adverse effects of bisphenol a and substitutes during human adipocyte differentiation. Environ Int. 2021 Nov;156:106730. doi: 10.1016/j.envint.2021.106730. Epub 2021 Jun 27.
• [50] Central role of Nix in the autophagic response to ochratoxin A. Food Chem Toxicol. 2014 Jul;69:202-9. doi: 10.1016/j.fct.2014.04.017. Epub 2014 Apr 19.
• [51] Mechanistic and predictive profiling of 5-Fluorouracil resistance in human cancer cells. Cancer Res. 2004 Nov 15;64(22):8167-76. doi: 10.1158/0008-5472.CAN-04-0970.