Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTOJL31C)

• DOT Name: Probable serine carboxypeptidase CPVL (CPVL)
• Synonyms: EC 3.4.16.-; Carboxypeptidase, vitellogenic-like; Vitellogenic carboxypeptidase-like protein; VCP-like protein; hVLP
• Gene Name: CPVL
• Related Disease:
  Behcet disease
  Diabetic retinopathy
  Poliomyelitis
  Advanced cancer
  Alzheimer disease
  Cervical Intraepithelial neoplasia
  Head and neck cancer
  Head and neck carcinoma
  Hepatitis B virus infection
  Hepatitis E virus infection
  Herpes simplex infection
  Lyme disease
  Neoplasm
  Normal pressure hydrocephalus
  Psychotic disorder
  Relapsing fever
  Vitiligo
  Cervical carcinoma
  Endometrial carcinoma
  Osteoarthritis
  Basal cell carcinoma
  Basal cell neoplasm
  Sickle-cell anaemia
• UniProt ID: CPVL_HUMAN
• EC Number: 3.4.16.-
• Pfam ID: PF00450
• Sequence:
  MVGAMWKVIVSLVLLMPGPCDGLFRSLYRSVSMPPKGDSGQPLFLTPYIEAGKIQKGREL
  SLVGPFPGLNMKSYAGFLTVNKTYNSNLFFWFFPAQIQPEDAPVVLWLQGGPGGSSMFGL
  FVEHGPYVVTSNMTLRDRDFPWTTTLSMLYIDNPVGTGFSFTDDTHGYAVNEDDVARDLY
  SALIQFFQIFPEYKNNDFYVTGESYAGKYVPAIAHLIHSLNPVREVKINLNGIAIGDGYS
  DPESIIGGYAEFLYQIGLLDEKQKKYFQKQCHECIEHIRKQNWFEAFEILDKLLDGDLTS
  DPSYFQNVTGCSNYYNFLRCTEPEDQLYYVKFLSLPEVRQAIHVGNQTFNDGTIVEKYLR
  EDTVQSVKPWLTEIMNNYKVLIYNGQLDIIVAAALTERSLMGMDWKGSQEYKKAEKKVWK
  IFKSDSEVAGYIRQAGDFHQVIIRGGGHILPYDQPLRAFDMINRFIYGKGWDPYVG
• Function: May be involved in the digestion of phagocytosed particles in the lysosome, participation in an inflammatory protease cascade, and trimming of peptides for antigen presentation.
• Tissue Specificity: Expressed in macrophages but not in other leukocytes. Abundantly expressed in heart and kidney. Also expressed in spleen, leukocytes, and placenta.

Molecular Interaction Atlas (MIA) of This DOT

23 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Behcet disease	DISSYMBS	Definitive	Genetic Variation	[1]
Diabetic retinopathy	DISHGUJM	Definitive	Genetic Variation	[2]
Poliomyelitis	DISANFJN	Definitive	Biomarker	[3]
Advanced cancer	DISAT1Z9	Strong	Biomarker	[4]
Alzheimer disease	DISF8S70	Strong	Biomarker	[5]
Cervical Intraepithelial neoplasia	DISXP757	Strong	Biomarker	[6]
Head and neck cancer	DISBPSQZ	Strong	Genetic Variation	[7]
Head and neck carcinoma	DISOU1DS	Strong	Genetic Variation	[7]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[8]
Hepatitis E virus infection	DIS0TXIR	Strong	Biomarker	[9]
Herpes simplex infection	DISL1SAV	Strong	Biomarker	[10]
Lyme disease	DISO70G5	Strong	Biomarker	[11]
Neoplasm	DISZKGEW	Strong	Biomarker	[7]
Normal pressure hydrocephalus	DISOEFO9	Strong	Biomarker	[5]
Psychotic disorder	DIS4UQOT	Strong	Genetic Variation	[12]
Relapsing fever	DISEA4L7	Strong	Biomarker	[13]
Vitiligo	DISR05SL	Strong	Genetic Variation	[14]
Cervical carcinoma	DIST4S00	moderate	Biomarker	[15]
Endometrial carcinoma	DISXR5CY	moderate	Genetic Variation	[16]
Osteoarthritis	DIS05URM	moderate	Biomarker	[17]
Basal cell carcinoma	DIS7PYN3	Limited	Genetic Variation	[18]
Basal cell neoplasm	DIS37IXW	Limited	Genetic Variation	[18]
Sickle-cell anaemia	DIS5YNZB	Limited	Biomarker	[19]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Mitoxantrone	DMM39BF	Approved	Probable serine carboxypeptidase CPVL (CPVL) affects the response to substance of Mitoxantrone.	[31]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[20]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[21]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[22]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[23]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[24]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[25]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[26]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[26]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[28]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Probable serine carboxypeptidase CPVL (CPVL).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the methylation of Probable serine carboxypeptidase CPVL (CPVL).	[29]

References

• [1] Replication study confirms the association between UBAC2 and Behet's disease in two independent Chinese sets of patients and controls.Arthritis Res Ther. 2012 Mar 29;14(2):R70. doi: 10.1186/ar3789.
• [2] CPVL/CHN2 genetic variant is associated with diabetic retinopathy in Chinese type 2 diabetic patients.Diabetes. 2011 Nov;60(11):3085-9. doi: 10.2337/db11-0028. Epub 2011 Sep 12.
• [3] Plant-made polio type 3 stabilized VLPs-a candidate synthetic polio vaccine.Nat Commun. 2017 Aug 15;8(1):245. doi: 10.1038/s41467-017-00090-w.
• [4] Improved Stable Indocyanine Green (ICG)-Mediated Cancer Optotheranostics with Naturalized Hepatitis B Core Particles.Adv Mater. 2018 Jul;30(28):e1707567. doi: 10.1002/adma.201707567. Epub 2018 May 22.
• [5] Concurrent Alzheimer's pathology in patients with clinical normal pressure hydrocephalus.J Neurosurg Sci. 2020 Apr;64(2):130-132. doi: 10.23736/S0390-5616.18.04350-3. Epub 2018 Feb 13.
• [6] Immune responses against human papillomavirus (HPV) type 16 virus-like particles in a cohort study of women with cervical intraepithelial neoplasia. I. Differential T-helper and IgG responses in relation to HPV infection and disease outcome.J Gen Virol. 1999 Feb;80 ( Pt 2):399-408. doi: 10.1099/0022-1317-80-2-399.
• [7] Human papillomavirus seropositivity and risks of head and neck cancer.Int J Cancer. 2007 Feb 15;120(4):825-32. doi: 10.1002/ijc.22330.
• [8] SplitCore Technology Allows Efficient Production of Virus-Like Particles Presenting a Receptor-Contacting Epitope of Human IgE.Mol Biotechnol. 2015 Aug;57(8):746-55. doi: 10.1007/s12033-015-9867-0.
• [9] Induction of antibody response against hepatitis E virus (HEV) with recombinant human papillomavirus pseudoviruses expressing truncated HEV capsid proteins in mice.Vaccine. 2008 Dec 2;26(51):6602-7. doi: 10.1016/j.vaccine.2008.09.035.
• [10] Prevalence of human papillomavirus infection in women in Busan, South Korea.Int J Cancer. 2003 Jan 20;103(3):413-21. doi: 10.1002/ijc.10825.
• [11] Eliminating Factor H-Binding Activity of Borrelia burgdorferi CspZ Combined with Virus-Like Particle Conjugation Enhances Its Efficacy as a Lyme Disease Vaccine.Front Immunol. 2018 Feb 8;9:181. doi: 10.3389/fimmu.2018.00181. eCollection 2018.
• [12] Genome-wide association study of atypical psychosis.Am J Med Genet B Neuropsychiatr Genet. 2013 Oct;162B(7):679-86. doi: 10.1002/ajmg.b.32164.
• [13] Genome-wide analysis of Borrelia turcica and 'Candidatus Borrelia tachyglossi' shows relapsing fever-like genomes with unique genomic links to Lyme disease Borrelia.Infect Genet Evol. 2018 Dec;66:72-81. doi: 10.1016/j.meegid.2018.09.013. Epub 2018 Sep 18.
• [14] Genome-wide association studies of autoimmune vitiligo identify 23 new risk loci and highlight key pathways and regulatory variants.Nat Genet. 2016 Nov;48(11):1418-1424. doi: 10.1038/ng.3680. Epub 2016 Oct 10.
• [15] Serologic response to human papillomavirus type 16 virus-like particles in Korean women with cervical precancerous and cancerous lesions.Arch Pharm Res. 2009 Mar;32(3):383-9. doi: 10.1007/s12272-009-1311-1. Epub 2009 Apr 23.
• [16] Identification of nine new susceptibility loci for endometrial cancer.Nat Commun. 2018 Aug 9;9(1):3166. doi: 10.1038/s41467-018-05427-7.
• [17] Global transcriptome analysis to identify critical genes involved in the pathology of osteoarthritis.Bone Joint Res. 2018 May 5;7(4):298-307. doi: 10.1302/2046-3758.74.BJR-2017-0245.R1. eCollection 2018 Apr.
• [18] Combined analysis of keratinocyte cancers identifies novel genome-wide loci.Hum Mol Genet. 2019 Sep 15;28(18):3148-3160. doi: 10.1093/hmg/ddz121.
• [19] Saccharomyces cerevisiae-derived virus-like particle parvovirus B19 vaccine elicits binding and neutralizing antibodies in a mouse model for sickle cell disease.Vaccine. 2017 Jun 22;35(29):3615-3620. doi: 10.1016/j.vaccine.2017.05.022. Epub 2017 May 26.
• [20] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [21] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [22] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [23] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [24] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [25] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [26] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [27] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [28] Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
• [29] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [30] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [31] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.