Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTQ3QNNU)

• DOT Name: ADP-ribosylation factor-like protein 4C (ARL4C)
• Synonyms: ADP-ribosylation factor-like protein 7; ADP-ribosylation factor-like protein LAK
• Gene Name: ARL4C
• Related Disease:
  Adult glioblastoma
  Glioblastoma multiforme
  Neoplasm of esophagus
  Advanced cancer
  Colorectal carcinoma
  Colorectal neoplasm
  Depression
  Fibrosarcoma
  Hepatocellular carcinoma
  Immunodeficiency
  Liver cancer
  Lung cancer
  Lung carcinoma
  Lung squamous cell carcinoma
  Clear cell renal carcinoma
  Gastric cancer
  Leiomyosarcoma
  Renal cell carcinoma
  Stomach cancer
• UniProt ID: ARL4C_HUMAN
• Pfam ID: PF00025
• Sequence:
  MGNISSNISAFQSLHIVMLGLDSAGKTTVLYRLKFNEFVNTVPTIGFNTEKIKLSNGTAK
  GISCHFWDVGGQEKLRPLWKSYSRCTDGIIYVVDSVDVDRLEEAKTELHKVTKFAENQGT
  PLLVIANKQDLPKSLPVAEIEKQLALHELIPATTYHVQPACAIIGEGLTEGMDKLYEMIL
  KRRKSLKQKKKR
• Function: Small GTP-binding protein which cycles between an inactive GDP-bound and an active GTP-bound form, and the rate of cycling is regulated by guanine nucleotide exchange factors (GEF) and GTPase-activating proteins (GAP). GTP-binding protein that does not act as an allosteric activator of the cholera toxin catalytic subunit. May be involved in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway. Recruits CYTH1, CYTH2, CYTH3 and CYTH4 to the plasma membrane in the GDP-bound form. Regulates the microtubule-dependent intracellular vesicular transport from early endosome to recycling endosome process.
• Tissue Specificity: Expressed in several tumor cell lines (at protein level). Expressed in lung, brain, leukocytes and placenta.
• Reactome Pathway: NR1H3 & NR1H2 regulate gene expression linked to cholesterol transport and efflux (R-HSA-9029569)

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Adult glioblastoma	DISVP4LU	Definitive	Biomarker	[1]
Glioblastoma multiforme	DISK8246	Definitive	Altered Expression	[1]
Neoplasm of esophagus	DISOLKAQ	Definitive	Biomarker	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[3]
Colorectal neoplasm	DISR1UCN	Strong	Biomarker	[4]
Depression	DIS3XJ69	Strong	Altered Expression	[5]
Fibrosarcoma	DISWX7MU	Strong	Biomarker	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[3]
Immunodeficiency	DIS093I0	Strong	Biomarker	[3]
Liver cancer	DISDE4BI	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[3]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[3]
Lung squamous cell carcinoma	DISXPIBD	Strong	Altered Expression	[7]
Clear cell renal carcinoma	DISBXRFJ	Limited	Biomarker	[8]
Gastric cancer	DISXGOUK	Limited	Biomarker	[9]
Leiomyosarcoma	DIS6COXM	Limited	Biomarker	[10]
Renal cell carcinoma	DISQZ2X8	Limited	Biomarker	[8]
Stomach cancer	DISKIJSX	Limited	Biomarker	[9]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of ADP-ribosylation factor-like protein 4C (ARL4C).	[11]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of ADP-ribosylation factor-like protein 4C (ARL4C).	[17]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of ADP-ribosylation factor-like protein 4C (ARL4C).	[35]

30 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[12]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[13]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[14]
Doxorubicin	DMVP5YE	Approved	Doxorubicin increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[15]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[16]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[18]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[19]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[20]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[21]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[22]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[23]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[24]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[25]
Folic acid	DMEMBJC	Approved	Folic acid affects the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[26]
Bortezomib	DMNO38U	Approved	Bortezomib decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[27]
Irinotecan	DMP6SC2	Approved	Irinotecan increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[28]
Indomethacin	DMSC4A7	Approved	Indomethacin decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[29]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[30]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[31]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[32]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[13]
DNCB	DMDTVYC	Phase 2	DNCB increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[33]
PD-0325901	DM27D4J	Phase 2	PD-0325901 decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[34]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[36]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[37]
Eugenol	DM7US1H	Patented	Eugenol increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[33]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[38]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[39]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of ADP-ribosylation factor-like protein 4C (ARL4C).	[40]

References

• [1] ARL4C stabilized by AKT/mTOR pathway promotes the invasion of PTEN-deficient primary human glioblastoma.J Pathol. 2019 Feb;247(2):266-278. doi: 10.1002/path.5189. Epub 2018 Dec 24.
• [2] Cisplatin induces fas expression in esophageal cancer cell lines and enhanced cytotoxicity in combination with LAK cells.Oncology. 2000 Nov;59(4):336-43. doi: 10.1159/000012192.
• [3] Chemically Modified Antisense Oligonucleotide Against ARL4C Inhibits Primary and Metastatic Liver Tumor Growth.Mol Cancer Ther. 2019 Mar;18(3):602-612. doi: 10.1158/1535-7163.MCT-18-0824. Epub 2019 Jan 15.
• [4] Clinical and prognostic significance of Arl4c expression in colorectal cancer.Cancer Biomark. 2016;16(2):253-7. doi: 10.3233/CBM-150562.
• [5] Induction of metastatic cancer stem cells from the NK/LAK-resistant floating, but not adherent, subset of the UP-LN1 carcinoma cell line by IFN-.Lab Invest. 2011 Oct;91(10):1502-13. doi: 10.1038/labinvest.2011.91. Epub 2011 Jun 20.
• [6] Soluble tumor necrosis factor receptor type I enhances tumor development and persistence in vivo.Cell Immunol. 2000 Mar 15;200(2):81-7. doi: 10.1006/cimm.2000.1622.
• [7] Epigenetic upregulation of ARL4C, due to DNA hypomethylation in the 3'-untranslated region, promotes tumorigenesis of lung squamous cell carcinoma.Oncotarget. 2016 Dec 6;7(49):81571-81587. doi: 10.18632/oncotarget.13147.
• [8] Analysis of the characteristics of chemotherapy-resistant renal cell carcinomas based on global transcriptional analysis of their tissues and cell lines.PLoS One. 2019 Nov 27;14(11):e0225721. doi: 10.1371/journal.pone.0225721. eCollection 2019.
• [9] Identification of ARL4C as a Peritoneal Dissemination-Associated Gene and Its Clinical Significance in Gastric Cancer.Ann Surg Oncol. 2018 Mar;25(3):745-753. doi: 10.1245/s10434-017-6292-6. Epub 2017 Dec 21.
• [10] Clinically Relevant Molecular Subtypes in Leiomyosarcoma.Clin Cancer Res. 2015 Aug 1;21(15):3501-11. doi: 10.1158/1078-0432.CCR-14-3141. Epub 2015 Apr 20.
• [11] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [12] Cyclosporine A--induced oxidative stress in human renal mesangial cells: a role for ERK 1/2 MAPK signaling. Toxicol Sci. 2012 Mar;126(1):101-13.
• [13] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [14] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [15] RNA sequence analysis of inducible pluripotent stem cell-derived cardiomyocytes reveals altered expression of DNA damage and cell cycle genes in response to doxorubicin. Toxicol Appl Pharmacol. 2018 Oct 1;356:44-53.
• [16] Estradiol and selective estrogen receptor modulators differentially regulate target genes with estrogen receptors alpha and beta. Mol Biol Cell. 2004 Mar;15(3):1262-72. doi: 10.1091/mbc.e03-06-0360. Epub 2003 Dec 29.
• [17] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [18] Changes in gene expression profiles of multiple myeloma cells induced by arsenic trioxide (ATO): possible mechanisms to explain ATO resistance in vivo. Br J Haematol. 2005 Mar;128(5):636-44.
• [19] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [20] Identification of vitamin D3 target genes in human breast cancer tissue. J Steroid Biochem Mol Biol. 2016 Nov;164:90-97.
• [21] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [22] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [23] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [24] Unique transcriptome, pathways, and networks in the human endometrial fibroblast response to progesterone in endometriosis. Biol Reprod. 2011 Apr;84(4):801-15.
• [25] Pharmacogenomic identification of novel determinants of response to chemotherapy in colon cancer. Cancer Res. 2006 Mar 1;66(5):2765-77.
• [26] Folate deficiency in normal human fibroblasts leads to altered expression of genes primarily linked to cell signaling, the cytoskeleton and extracellular matrix. J Nutr Biochem. 2007 Aug;18(8):541-52. doi: 10.1016/j.jnutbio.2006.11.002. Epub 2007 Feb 22.
• [27] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [28] Clinical determinants of response to irinotecan-based therapy derived from cell line models. Clin Cancer Res. 2008 Oct 15;14(20):6647-55.
• [29] Mechanisms of indomethacin-induced alterations in the choline phospholipid metabolism of breast cancer cells. Neoplasia. 2006 Sep;8(9):758-71.
• [30] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [31] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [32] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [33] Microarray analyses in dendritic cells reveal potential biomarkers for chemical-induced skin sensitization. Mol Immunol. 2007 May;44(12):3222-33.
• [34] PRC2 loss amplifies Ras-driven transcription and confers sensitivity to BRD4-based therapies. Nature. 2014 Oct 9;514(7521):247-51.
• [35] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [36] Bromodomain-containing protein 4 (BRD4) regulates RNA polymerase II serine 2 phosphorylation in human CD4+ T cells. J Biol Chem. 2012 Dec 14;287(51):43137-55.
• [37] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [38] Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
• [39] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [40] Transcriptomic alterations induced by Ochratoxin A in rat and human renal proximal tubular in vitro models and comparison to a rat in vivo model. Arch Toxicol. 2012 Apr;86(4):571-89.