Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTSLZBVY)

• DOT Name: Tyrosine-protein phosphatase non-receptor type 3 (PTPN3)
• Synonyms: EC 3.1.3.48; Protein-tyrosine phosphatase H1; PTP-H1
• Gene Name: PTPN3
• Related Disease:
  Acromegaly
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Cholangiocarcinoma
  Colorectal carcinoma
  Gastric adenocarcinoma
  Gastric cancer
  Glioma
  Hepatitis B virus infection
  Hepatocellular carcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Neoplasm
  Non-small-cell lung cancer
  Skin cancer
  Stomach cancer
  Triple negative breast cancer
  Basal cell nevus syndrome
  Intrahepatic cholangiocarcinoma
  Adult glioblastoma
  Colon cancer
  Colon carcinoma
  Glioblastoma multiforme
  Schizophrenia
• UniProt ID: PTN3_HUMAN
• PDB ID: 2B49; 4QUM; 4QUN; 4RH5; 4RH9; 4RHG; 4RI4; 4RI5; 4S0G; 6HKS; 6T36; 8CQY; 8OEP
• EC Number: 3.1.3.48
• Pfam ID: PF09380 ; PF00373 ; PF09379 ; PF00595 ; PF00102
• Sequence:
  MTSRLRALGGRINNIRTSELPKEKTRSEVICSIHFLDGVVQTFKVTKQDTGQVLLDMVHN
  HLGVTEKEYFGLQHDDDSVDSPRWLEASKAIRKQLKGGFPCTLHFRVRFFIPDPNTLQQE
  QTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQSHFGDYNSSIHHPGYLSDSHFIPDQ
  NEDFLTKVESLHEQHSGLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAG
  VAVYRKYICTSFYPWVNILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKS
  CVEHHTFFQAKKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVIGGMVWNPAMRRSLSV
  EHLETKSLPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSL
  APQDSDSEVSQNRSPHQESLSENNPAQSYLTQKSSSSVSPSSNAPGSCSPDGVDQQLLDD
  FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI
  NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR
  SFADFKSEDELNQLFPEAIFPMCPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPGL
  AITFAKLPQNLDKNRYKDVLPYDTTRVLLQGNEDYINASYVNMEIPAANLVNKYIATQGP
  LPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDVMNHGGFHIQCQSEDCT
  IAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRVDSEPVLV
  HCSAGIGRTGVLVTMETAMCLTERNLPIYPLDIVRKMRDQRAMMVQTSSQYKFVCEAILR
  VYEEGLVQMLDPS
• Function: May act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity.
• Reactome Pathway:
  Negative regulation of MAPK pathway (R-HSA-5675221)
  EGFR downregulation (R-HSA-182971)

Molecular Interaction Atlas (MIA) of This DOT

26 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Acromegaly	DISCC73U	Strong	Biomarker	[1]
Advanced cancer	DISAT1Z9	Strong	Posttranslational Modification	[2]
Breast cancer	DIS7DPX1	Strong	Posttranslational Modification	[2]
Breast carcinoma	DIS2UE88	Strong	Posttranslational Modification	[2]
Cholangiocarcinoma	DIS71F6X	Strong	Altered Expression	[3]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[2]
Gastric adenocarcinoma	DISWWLTC	Strong	Biomarker	[4]
Gastric cancer	DISXGOUK	Strong	Biomarker	[5]
Glioma	DIS5RPEH	Strong	Genetic Variation	[2]
Hepatitis B virus infection	DISLQ2XY	Strong	Biomarker	[6]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[6]
Lung cancer	DISCM4YA	Strong	Biomarker	[7]
Lung carcinoma	DISTR26C	Strong	Biomarker	[7]
Lung neoplasm	DISVARNB	Strong	Biomarker	[8]
Neoplasm	DISZKGEW	Strong	Biomarker	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[8]
Skin cancer	DISTM18U	Strong	Altered Expression	[10]
Stomach cancer	DISKIJSX	Strong	Biomarker	[5]
Triple negative breast cancer	DISAMG6N	Strong	Biomarker	[11]
Basal cell nevus syndrome	DIST8BC2	moderate	Biomarker	[12]
Intrahepatic cholangiocarcinoma	DIS6GOC8	moderate	Genetic Variation	[13]
Adult glioblastoma	DISVP4LU	Limited	Altered Expression	[4]
Colon cancer	DISVC52G	Limited	Genetic Variation	[2]
Colon carcinoma	DISJYKUO	Limited	Genetic Variation	[2]
Glioblastoma multiforme	DISK8246	Limited	Altered Expression	[4]
Schizophrenia	DISSRV2N	No Known	Unknown	[14]

4 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[15]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 affects the phosphorylation of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[33]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[34]
Coumarin	DM0N8ZM	Investigative	Coumarin decreases the phosphorylation of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[33]

22 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[16]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[17]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[18]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[19]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[20]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[21]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[22]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[23]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[17]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[24]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[25]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[26]
DTI-015	DMXZRW0	Approved	DTI-015 decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[27]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[28]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[29]
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[30]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[28]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[31]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[32]
Milchsaure	DM462BT	Investigative	Milchsaure decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[35]
crotylaldehyde	DMTWRQI	Investigative	crotylaldehyde decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[36]
N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE	DM2D4KY	Investigative	N-(3-METHYLBUT-2-EN-1-YL)-9H-PURIN-6-AMINE decreases the expression of Tyrosine-protein phosphatase non-receptor type 3 (PTPN3).	[17]

References

• [1] Gene Expression Signature in Adipose Tissue of Acromegaly Patients.PLoS One. 2015 Jun 18;10(6):e0129359. doi: 10.1371/journal.pone.0129359. eCollection 2015.
• [2] PTPH1 immunohistochemical expression and promoter methylation in breast cancer patients from India: A retrospective study.J Cell Physiol. 2019 Feb;234(2):1071-1079. doi: 10.1002/jcp.27211. Epub 2018 Sep 6.
• [3] Activating mutations in PTPN3 promote cholangiocarcinoma cell proliferation and migration and are associated with tumor recurrence in patients.Gastroenterology. 2014 May;146(5):1397-407. doi: 10.1053/j.gastro.2014.01.062. Epub 2014 Feb 4.
• [4] High Expression of PTPN3 Predicts Progression and Unfavorable Prognosis of Glioblastoma.Med Sci Monit. 2018 Oct 23;24:7556-7562. doi: 10.12659/MSM.911531.
• [5] PTPN3 and PTPN4 tyrosine phosphatase expression in human gastric adenocarcinoma.Anticancer Res. 2006 Mar-Apr;26(2B):1643-9.
• [6] Suppression of hepatitis B viral gene expression by protein-tyrosine phosphatase PTPN3.J Biomed Sci. 2007 Nov;14(6):731-44. doi: 10.1007/s11373-007-9187-x. Epub 2007 Jun 24.
• [7] PTPN3 suppresses lung cancer cell invasiveness by counteracting Src-mediated DAAM1 activation and actin polymerization.Oncogene. 2019 Oct;38(44):7002-7016. doi: 10.1038/s41388-019-0948-6. Epub 2019 Aug 12.
• [8] Protein tyrosine phosphatase PTPN3 inhibits lung cancer cell proliferation and migration by promoting EGFR endocytic degradation.Oncogene. 2015 Jul;34(29):3791-803. doi: 10.1038/onc.2014.312. Epub 2014 Sep 29.
• [9] PTPN3 suppresses the proliferation and correlates with favorable prognosis of perihilar cholangiocarcinoma by inhibiting AKT phosphorylation.Biomed Pharmacother. 2020 Jan;121:109583. doi: 10.1016/j.biopha.2019.109583. Epub 2019 Nov 6.
• [10] The Protein Tyrosine Phosphatase H1 PTPH1 Supports Proliferation of Keratinocytes and is a Target of the Human Papillomavirus Type 8 E6 Oncogene.Cells. 2019 Mar 14;8(3):244. doi: 10.3390/cells8030244.
• [11] NOTCH3 inactivation increases triple negative breast cancer sensitivity to gefitinib by promoting EGFR tyrosine dephosphorylation and its intracellular arrest.Oncogenesis. 2018 May 25;7(5):42. doi: 10.1038/s41389-018-0051-9.
• [12] Expression and chromosomal assignment of PTPH1 gene encoding a cytosolic protein tyrosine phosphatase homologous to cytoskeletal-associated proteins.Int J Cancer. 1993 Dec 2;55(6):947-51. doi: 10.1002/ijc.2910550612.
• [13] PTPN3 acts as a tumor suppressor and boosts TGF- signaling independent of its phosphatase activity.EMBO J. 2019 Jul 15;38(14):e99945. doi: 10.15252/embj.201899945. Epub 2019 Jun 14.
• [14] De novo mutations in schizophrenia implicate synaptic networks. Nature. 2014 Feb 13;506(7487):179-84. doi: 10.1038/nature12929. Epub 2014 Jan 22.
• [15] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [16] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [17] Immediate up-regulation of the calcium-binding protein S100P and its involvement in the cytokinin-induced differentiation of human myeloid leukemia cells. Biochim Biophys Acta. 2005 Sep 10;1745(2):156-65.
• [18] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [19] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [20] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [21] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [22] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [23] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [24] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [25] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [26] Gene expression signatures after ethanol exposure in differentiating embryoid bodies. Toxicol In Vitro. 2018 Feb;46:66-76.
• [27] Gene expression profile induced by BCNU in human glioma cell lines with differential MGMT expression. J Neurooncol. 2005 Jul;73(3):189-98.
• [28] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [29] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [30] Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
• [31] Genome-wide transcriptional and functional analysis of human T lymphocytes treated with benzo[alpha]pyrene. Int J Mol Sci. 2018 Nov 17;19(11).
• [32] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [33] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [34] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [35] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [36] Gene expression profile and cytotoxicity of human bronchial epithelial cells exposed to crotonaldehyde. Toxicol Lett. 2010 Aug 16;197(2):113-22.